KEGG   Homo sapiens (human): 55054
Entry
55054             CDS       T01001                                 

Gene name
ATG16L1, APG16L, ATG16A, ATG16L, IBD10, WDR30
Definition
(RefSeq) autophagy related 16 like 1
  KO
K17890  autophagy-related protein 16-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N01284  Shigella IcsP to Autophagy-vesicle elongation
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    55054 (ATG16L1)
   04136 Autophagy - other
    55054 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    55054 (ATG16L1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    55054 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55054 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    55054 (ATG16L1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    55054 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    55054 (ATG16L1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    55054 (ATG16L1)
SSDB
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Nup160 TolB_like DUF3293
Other DBs
NCBI-GeneID: 55054
NCBI-ProteinID: NP_110430
OMIM: 610767
HGNC: 21498
Ensembl: ENSG00000085978
Pharos: Q676U5(Tbio)
UniProt: Q676U5 Q17RG0
LinkDB
Structure
PDB: 

Position
2q37.1
AA seq 607 aa
MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEK
HDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRK
DREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKL
RKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDI
EVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDT
HPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKG
SLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSES
IVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRV
VFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCK
AVLWAQY
NT seq 1824 nt   +upstreamnt  +downstreamnt
atgtcgtcgggcctccgcgccgctgacttcccccgctggaagcgccacatctcggagcaa
ctgaggcgccgggaccggctgcagagacaggcgttcgaggagatcatcctgcagtataac
aaattgctggaaaagtcagatcttcattcagtgttggcccagaaactacaggctgaaaag
catgacgtaccaaacaggcacgagataagtcccggacatgatggcacatggaatgacaat
cagctacaagaaatggcccaactgaggattaagcaccaagaggaactgactgaattacac
aagaaacgtggggagttagctcaactggtgattgacctgaataaccaaatgcagcggaag
gacagggagatgcagatgaatgaagcaaaaattgcagaatgtttgcagactatctctgac
ctggagacggagtgcctagacctgcgcactaagctttgtgaccttgaaagagccaaccag
accctgaaggatgaatatgatgccctgcagatcacttttactgccttggagggaaaactg
aggaaaactacggaagagaaccaggagctggtcaccagatggatggctgagaaagcccag
gaagccaatcggcttaatgcagagaatgaaaaagactccaggaggcggcaagcccggctg
cagaaagagcttgcagaagcagcaaaggaacctctaccagtcgaacaggatgatgacatt
gaggtcattgtggatgaaacttctgatcacacagaagagacctctcctgtgcgagccatc
agcagagcagccactaagcgactctcgcagcctgctggaggccttctggattctatcact
aatatctttgggagacgctctgtctcttccttcccagtcccccaggacaatgtggatact
catcctggttctggtaaagaagtgagggtaccagctactgccttgtgtgtcttcgatgca
catgatggggaagtcaacgctgtgcagttcagtccaggttcccggttactggccactgga
ggcatggaccgcagggttaagctttgggaagtatttggagaaaaatgtgagttcaagggt
tccctatctggcagtaatgcaggaattacaagcattgaatttgatagtgctggatcttac
ctcttagcagcttcaaatgattttgcaagccgaatctggactgtggatgattatcgatta
cggcacacactcacgggacacagtgggaaagtgctgtctgctaagttcctgctggacaat
gcgcggattgtctcaggaagtcacgaccggactctcaaactctgggatctacgcagcaaa
gtctgcataaagacagtgtttgcaggatccagttgcaatgatattgtctgcacagagcaa
tgtgtaatgagtggacattttgacaagaaaattcgtttctgggacattcgatcagagagc
atagttcgagagatggagctgttgggaaagattactgccctggacttaaacccagaaagg
actgagctcctgagctgctcccgtgatgacttgctaaaagttattgatctccgaacaaat
gctatcaagcagacattcagtgcacctgggttcaagtgcggctctgactggaccagagtt
gtcttcagccctgatggcagttacgtggcggcaggctctgctgagggctctctgtatatc
tggagtgtgctcacagggaaagtggaaaaggttctttcaaagcagcacagctcatccatc
aatgcggtggcgtggtcgccctctggctcgcacgttgtcagtgtggacaaaggatgcaaa
gctgtgctgtgggcacagtactga

KEGG   Homo sapiens (human): 89849
Entry
89849             CDS       T01001                                 

Gene name
ATG16L2, ATG16B, WDR80
Definition
(RefSeq) autophagy related 16 like 2
  KO
K20868  autophagy-related protein 16-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
Network
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
  Element
N00156  Autophagy-vesicle elongation
N01284  Shigella IcsP to Autophagy-vesicle elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    89849 (ATG16L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    89849 (ATG16L2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    89849 (ATG16L2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    89849 (ATG16L2)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    89849 (ATG16L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    89849 (ATG16L2)
SSDB
Motif
Pfam: ATG16 WD40 Phage_GP20
Other DBs
NCBI-GeneID: 89849
NCBI-ProteinID: NP_203746
OMIM: 618716
HGNC: 25464
Ensembl: ENSG00000168010
Vega: OTTHUMG00000167961
Pharos: Q8NAA4(Tbio)
UniProt: Q8NAA4 Q9H7Q5
LinkDB
Position
11q13.4
AA seq 619 aa
MAGPGVPGAPAARWKRHIVRQLRLRDRTQKALFLELVPAYNHLLEKAELLDKFSKKLQPE
PNSVTPTTHQGPWEESELDSDQVPSLVALRVKWQEEEEGLRLVCGEMAYQVVEKGAALGT
LESELQQRQSRLAALEARVAQLREARAQQAQQVEEWRAQNAVQRAAYEALRAHVGLREAA
LRRLQEEARDLLERLVQRKARAAAERNLRNERRERAKQARVSQELKKAAKRTVSISEGPD
TLGDGMRERRETLALAPEPEPLEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKR
RGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNSSLLATGGADRLI
HLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSG
HKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGH
NDQKIRFWDSRGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVF
RADGFKCGSDWTKAVFSPDRSYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWC
YSGSHMVSVDQGRKVVLWQ
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcggggccgggcgtccccggtgcccccgcagcgcgctggaaacgccacatcgtgcgg
cagctgcggcttcgggaccgtacgcaaaaggcgcttttcctggagctggtgccggcctat
aaccatctcttagagaaggctgagctgctggacaagttctcaaagaagctgcagccggag
ccaaacagtgtcactcccaccacccaccagggcccctgggaggagtcagagcttgactca
gaccaagtcccatcactggtcgcactgagggtgaagtggcaggaggaggaggaggggctc
cggctggtctgtggtgagatggcctaccaggtggtggagaagggcgcggccctgggcacg
ctggagtcggagctgcagcagaggcaaagcaggctggcagccctggaggcccgcgtggcg
cagctgcgagaggcgcgggcgcagcaggcccagcaggtggaggagtggcgggcgcagaat
gcggtgcagcgggcagcctacgaggcgctgcgcgcgcacgtcgggctccgggaggcggca
ctgcgcaggctccaggaagaggcgcgcgacctgctggagaggctcgtgcagcgcaaggcg
cgcgccgcggccgagcgcaacctgcgcaacgagcgccgggagcgggccaagcaggcgcgg
gtgtcccaggagctgaagaaggctgccaagcggaccgtgagcatcagcgagggcccggac
accctaggcgatgggatgagggagagaagggagactctggctctggcccctgagccagag
cccctggagaaggaagcttgtgagaagtggaagaggcccttcaggtctgcctcagccacc
tccctgacgctgtcccactgtgtggatgtggtgaaggggcttctggattttaagaagagg
agaggtcactcaattgggggagcccctgagcagcgataccagatcatccctgtgtgtgtg
gctgcccgacttcctacccgggctcaggatgtgctggatgcccacctctctgaggtcaat
gctgttcgttttggccccaacagcagcctcctggccactggaggggctgaccgcctgatc
cacctctggaatgttgtgggaagtcgcctggaggccaaccagaccctggagggagctggt
ggcagcatcaccagtgtggactttgacccctcgggctaccaggttttagcagcaacttac
aaccaggctgcccagctctggaaggtgggggaggcacagtccaaggagacactgtctgga
cacaaggataaggtgacagctgccaaattcaagctaacgaggcaccaggcagtgactggg
agccgcgaccggacagtgaaggagtgggacctcggccgtgcctattgctccaggaccatc
aatgtcctttcctactgtaatgacgtggtgtgtggggaccatatcatcattagtggccac
aatgaccagaagatccggttctgggacagcagggggccccactgcacccaggtcatccct
gtgcagggccgggtcacctccctgagcctcagccacgaccaactgcacctgctcagctgt
tcccgagacaacacactcaaggtcatcgacctgcgtgtcagcaacatccgccaggtgttc
agggccgatggcttcaagtgtggttctgactggaccaaagctgtgttcagcccggacaga
agctatgcactggcaggctcctgtgatggggccctttacatctgggatgtggacaccggg
aaactggagagcagactacagggaccccattgcgctgccgtcaacgccgtggcctggtgc
tactccgggagccacatggtgagcgtggaccagggcaggaaggttgtgctctggcagtag

DBGET integrated database retrieval system