KEGG   Homo sapiens (human): 5861
Entry
5861              CDS       T01001                                 

Gene name
RAB1A, RAB1, YPT1
Definition
(RefSeq) RAB1A, member RAS oncogene family
  KO
K07874  Ras-related protein Rab-1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05134  Legionellosis
Network
nt06413  Autophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01142  C9orf72-mediated autophagy initiation
N01143  Mutation-inactivated C9orf72 to C9orf72-mediated autophagy initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5861 (RAB1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    5861 (RAB1A)
   05022 Pathways of neurodegeneration - multiple diseases
    5861 (RAB1A)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    5861 (RAB1A)
   05134 Legionellosis
    5861 (RAB1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5861 (RAB1A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5861 (RAB1A)
   04031 GTP-binding proteins [BR:hsa04031]
    5861 (RAB1A)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    5861 (RAB1A)
 Autophagy
  Other autophagy associated proteins
    5861 (RAB1A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5861 (RAB1A)
  Exosomal proteins of other body fluids (saliva and urine)
   5861 (RAB1A)
  Exosomal proteins of colorectal cancer cells
   5861 (RAB1A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    5861 (RAB1A)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 SRPRB Gtr1_RagA AAA FeoB_N AAA_16 PduV-EutP AAA_7 AAA_29 AAA_22 ABC_tran Septin AAA_5 LANC_like TniB
Other DBs
NCBI-GeneID: 5861
NCBI-ProteinID: NP_004152
OMIM: 179508
HGNC: 9758
Ensembl: ENSG00000138069
Vega: OTTHUMG00000152725
Pharos: P62820(Tbio)
UniProt: P62820 Q5U0I6
LinkDB
Structure
PDB: 

Position
2p14
AA seq 205 aa
MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTI
KLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKL
LVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGA
TAGGAEKSNVKIQSTPVKQSGGGCC
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtccagcatgaatcccgaatatgattatttattcaagttacttctgattggcgactca
ggggttggaaagtcttgccttcttcttaggtttgcagatgatacatatacagaaagctac
atcagcacaattggtgtggatttcaaaataagaactatagagttagacgggaaaacaatc
aagcttcaaatatgggacacagcaggccaggaaagatttcgaacaatcacctccagttat
tacagaggagcccatggcatcatagttgtgtatgatgtgacagatcaggagtccttcaat
aatgttaaacagtggctgcaggaaatagatcgttatgccagtgaaaatgtcaacaaattg
ttggtagggaacaaatgtgatctgaccacaaagaaagtagtagactacacaacagcgaag
gaatttgctgattcccttggaattccgtttttggaaaccagtgctaagaatgcaacgaat
gtagaacagtctttcatgacgatggcagctgagattaaaaagcgaatgggtcccggagca
acagctggtggtgctgagaagtccaatgttaaaattcagagcactccagtcaagcagtca
ggtggaggttgctgctaa

DBGET integrated database retrieval system