KEGG   Homo sapiens (human): 7296
Entry
7296              CDS       T01001                                 

Gene name
TXNRD1, GRIM-12, TR, TR1, TRXR1, TXNR
Definition
(RefSeq) thioredoxin reductase 1
  KO
K22182  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00450  Selenocompound metabolism
hsa05200  Pathways in cancer
hsa05225  Hepatocellular carcinoma
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
nt06463  Parkinson disease
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    7296 (TXNRD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7296 (TXNRD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7296 (TXNRD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     7296 (TXNRD1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 Glutaredoxin FAD_oxidored AlaDh_PNT_C HI0933_like DAO Thi4 GIDA NAD_binding_8 FAD_binding_3 Lycopene_cycl
Other DBs
NCBI-GeneID: 7296
NCBI-ProteinID: NP_001087240
OMIM: 601112
HGNC: 12437
Ensembl: ENSG00000198431
Vega: OTTHUMG00000166481
Pharos: Q16881(Tclin)
UniProt: Q16881
LinkDB
Structure
PDB: 

Position
12q23.3
AA seq 649 aa
MGCAEGKAVAAAAPTELQTKGKNGDGRRRSAKDHHPGKTLPENPAGFTSTATADSRALLQ
AYIDGHSVVIFSRSTCTRCTEVKKLFKSLCVPYFVLELDQTEDGRALEGTLSELAAETDL
PVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKE
AAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
EETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEK
IYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLA
GIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVV
AQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIY
AIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKA
VEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQ
GFAAALKCGLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGCUG
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgggctgcgccgagggcaaggcagtggcggcggccgccccaacggagctgcagacgaaa
ggcaagaacggcgatggccgccgtaggtcagctaaagatcatcaccctggtaaaactttg
ccagagaacccagcaggattcaccagcacggccactgcagactccagagccctgcttcag
gcctatatagatggtcactctgtggtcatcttcagtaggtccacatgcacacgctgtact
gaggtaaagaagttatttaaatctctgtgtgttccttattttgtgcttgaacttgatcaa
acagaggacggtcgggccctggaaggaacgctctcggaattggccgcggaaaccgatctg
cccgttgtgtttgtgaaacagagaaagataggcggccatggtccaaccttgaaggcttat
caggagggcagacttcaaaagctactaaaaatgaacggccctgaagatcttcccaagtcc
tatgactatgaccttatcatcattggaggtggctcaggaggtctggcagctgctaaggag
gcagcccaatatggcaagaaggtgatggtcctggactttgtcactcccacccctcttgga
actagatggggtctcggaggaacatgtgtgaatgtgggttgcatacctaaaaaactgatg
catcaagcagctttgttaggacaagccctgcaagactctcgaaattatggatggaaagtc
gaggagacagttaagcatgattgggacagaatgatagaagctgtacagaatcacattggc
tctttgaattggggctaccgagtagctctgcgggagaaaaaagtcgtctatgagaatgct
tatgggcaatttattggtcctcacaggattaaggcaacaaataataaaggcaaagaaaaa
atttattcagcagagagatttctcattgccactggtgaaagaccacgttacttgggcatc
cctggtgacaaagaatactgcatcagcagtgatgatcttttctccttgccttactgcccg
ggtaagaccctggttgttggagcatcctatgtcgctttggagtgcgctggatttcttgct
ggtattggtttagacgtcactgttatggttaggtccattcttcttagaggatttgaccag
gacatggccaacaaaattggtgaacacatggaagaacatggcatcaagtttataagacag
ttcgtaccaattaaagttgaacaaattgaagcagggacaccaggccgactcagagtagta
gctcagtccaccaatagtgaggaaatcattgaaggagaatataatacggtgatgctggca
ataggaagagatgcttgcacaagaaaaattggcttagaaaccgtaggggtgaagataaat
gaaaagactggaaaaatacctgtcacagatgaagaacagaccaatgtgccttacatctat
gccattggcgatatattggaggataaggtggagctcaccccagttgcaatccaggcagga
agattgctggctcagaggctctatgcaggttccactgtcaagtgtgactatgaaaatgtt
ccaaccactgtatttactcctttggaatatggtgcttgtggcctttctgaggagaaagct
gtggagaagtttggggaagaaaatattgaggtttaccatagttacttttggccattggaa
tggacgattccgtcaagagataacaacaaatgttatgcaaaaataatctgtaatactaaa
gacaatgaacgtgttgtgggctttcacgtactgggtccaaatgctggagaagttacacaa
ggctttgcagctgcgctcaaatgtggactgaccaaaaagcagctggacagcacaattgga
atccaccctgtctgtgcagaggtattcacaacattgtctgtgaccaagcgctctggggca
agcatcctccaggctggctgctgaggttaa

DBGET integrated database retrieval system