KEGG   Homo sapiens (human): 765
Entry
765               CDS       T01001                                 

Gene name
CA6, CA-VI, GUSTIN
Definition
(RefSeq) carbonic anhydrase 6
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Drug target
Acetazolamide (DG01134): D00218<JP/US> D01196<JP/US>
Clofenamide: D01822
Diclofenamide: D00518<US>
Dorzolamide (DG01135): D00653<JP/US> D07871
Ethoxzolamide: D02441
Methazolamide: D00655<US>
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    765 (CA6)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     765 (CA6)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 765
NCBI-ProteinID: NP_001206
OMIM: 114780
HGNC: 1380
Ensembl: ENSG00000131686
Vega: OTTHUMG00000001763
Pharos: P23280(Tclin)
UniProt: P23280 B4DUH8
LinkDB
Structure
PDB: 
3FE4

Position
1p36.23
AA seq 308 aa
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagggccctggtgcttctgctgtccctgttcctgctgggtggccaggcccagcatgtg
tctgactggacctactcagaaggggcactggacgaagcgcactggccacagcactacccc
gcctgtgggggccagagacagtcgcctatcaacctacagaggacgaaggtgcggtacaac
ccctccttgaaggggctcaatatgacaggctatgagacccaggcaggggagttccccatg
gtcaacaatggccacacagtgcagatcagcctgccctccaccatgcgcatgacagtggct
gacggcactgtatacatagcccagcagatgcactttcactggggaggtgcgtcctcggag
atcagcggctctgagcacaccgtggacgggatcagacatgtgatcgagattcacattgtt
cactacaattctaaatacaagagctatgatatagcccaagatgcgccggatggtttggct
gtactggcagccttcgttgaggtgaagaattaccctgaaaacacttattacagcaacttc
atttctcatctggccaacatcaagtacccaggacaaagaacaaccctgactggccttgac
gttcaggacatgctgcccaggaacctccagcactactacacctaccatggctcactcacc
acgcctccctgcactgagaacgtccactggtttgtgctggcagattttgtcaagctctcc
aggacacaggtttggaagctggagaattccttactggatcaccgcaacaagaccatccac
aacgattaccgcaggacccagcccctgaaccacagagtggtggaatccaacttcccgaat
caggaatacactctaggctctgaattccagttttacctacataagattgaggaaattctt
gactacttaagaagagcattgaactga

DBGET integrated database retrieval system