KEGG   Homo sapiens (human): 767
Entry
767               CDS       T01001                                 

Gene name
CA8, CA-RP, CA-VIII, CALS, CAMRQ3, CARP
Definition
(RefSeq) carbonic anhydrase 8
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
Disease
H01204  Cerebellar ataxia, mental retardation (MR), and dysequilibrium syndrome (CAMRQ)
Drug target
Acetazolamide (DG01134): D00218<JP/US> D01196<JP/US>
Clofenamide: D01822
Diclofenamide: D00518<US>
Dorzolamide (DG01135): D00653<JP/US> D07871
Ethoxzolamide: D02441
Methazolamide: D00655<US>
Sezolamide hydrochloride: D03845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    767 (CA8)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     767 (CA8)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 767
NCBI-ProteinID: NP_001308766
OMIM: 114815
HGNC: 1382
Ensembl: ENSG00000178538
Vega: OTTHUMG00000165325
Pharos: P35219(Tbio)
UniProt: P35219
LinkDB
Structure
PDB: 
2W2J

Position
8q12.1
AA seq 290 aa
MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
NT seq 873 nt   +upstreamnt  +downstreamnt
atggcggacctgagcttcatcgaagataccgtcgccttccccgagaaggaagaggatgag
gaggaagaagaggagggtgtggagtggggctacgaggaaggtgttgagtggggtctggtg
tttcctgatgctaatggggaataccagtctcctattaacctaaactcaagagaggctagg
tatgacccctcgctgttggatgtccgcctctccccaaattatgtggtgtgccgagactgt
gaagtcaccaatgatggacataccattcaggttatcctgaagtcaaaatcagttctttcg
ggaggaccattgcctcaagggcatgaatttgaactgtacgaagtgagatttcactgggga
agagaaaaccagcgtggttctgagcacacggttaatttcaaagcttttcccatggagctc
catctgatccactggaactccactctgtttggcagcattgatgaggctgtggggaagccg
cacggaatcgccatcattgctctgtttgttcagataggaaaggaacatgttggcttgaag
gctgtgactgaaatcctccaagatattcagtataaggggaagtccaaaacaataccttgc
tttaatcctaacactttattaccagaccctctgctgcgggattactgggtgtatgaaggc
tctctcaccatcccaccttgcagtgaaggtgtcacctggatattattccgatacccttta
actatatcccagctacagatagaagaatttcgaaggctgaggacacatgttaagggggca
gaacttgtggaaggctgtgatgggattttgggagacaactttcggcccactcagcctctt
agtgacagagtcattagagctgcatttcagtag

DBGET integrated database retrieval system