KEGG   Homo sapiens (human): 7704Help
Entry
7704              CDS       T01001                                 

Gene name
ZBTB16, PLZF, ZNF145
Definition
(RefSeq) zinc finger and BTB domain containing 16
  KO
K10055  zinc finger and BTB domain-containing protein 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00110  PLZF-RARA fusion to transcriptional activtion
N00114  PLZF-RARA fusion to transcriptional repression
Disease
H00003  Acute myeloid leukemia (AML)
H00969  Skeletal defects, genital hypoplasia, and mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    7704 (ZBTB16)
   05202 Transcriptional misregulation in cancers
    7704 (ZBTB16)
   05221 Acute myeloid leukemia
    7704 (ZBTB16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     7704 (ZBTB16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 BTB zf-C2H2_6 zf-C2H2_jaz zf-met zf-C2H2_2 Endonuclease_7 zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 7704
NCBI-ProteinID: NP_001018011
OMIM: 176797
HGNC: 12930
Ensembl: ENSG00000109906
Vega: OTTHUMG00000168243
Pharos: Q05516(Tbio)
UniProt: Q05516 A0A024R3C6
LinkDB All DBs
Structure
PDB: 

Position
11q23.2
AA seq 673 aa AA seqDB search
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
MLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
ESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESRTIGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggatctgacaaaaatgggcatgatccagctgcagaaccctagccaccccacggggcta
ctgtgcaaggccaaccagatgcggctggccgggactttgtgcgatgtggtcatcatggtg
gacagccaggagttccacgcccaccggacggtgctggcctgcaccagcaagatgtttgag
atcctcttccaccgcaatagtcaacactatactttggacttcctctcgccaaagaccttc
cagcagattctggagtatgcatatacagccacgctgcaagccaaggcggaggacctggat
gacctgctgtatgcggccgagatcctggagatcgagtacctggaggaacagtgcctgaag
atgctggagaccatccaggcctcagacgacaatgacacggaggccaccatggccgatggc
ggggccgaggaagaagaggaccgcaaggctcggtacctcaagaacatcttcatctcgaag
cattccagcgaggagagtgggtatgccagtgtggctggacagagcctccctgggcccatg
gtggaccagagcccttcagtctccacttcatttggtctttcagccatgagtcccaccaag
gctgcagtggacagtttgatgaccataggacagtctctcctgcagggaactcttcagcca
cctgcagggcccgaggagccaactctggctgggggtgggcggcaccctggggtggctgag
gtgaagacggagatgatgcaggtggatgaggtgcccagccaggacagccctggggcagcc
gagtccagcatctcaggagggatgggggacaaggttgaggaaagaggcaaagaggggcct
gggaccccgactcgaagcagcgtcatcaccagtgctagggagctacactatgggcgagag
gagagtgccgagcaggtgccacccccagctgaggctggccaggcccccactggccgacct
gagcacccagcacccccgcctgagaagcatctgggcatctactccgtgttgcccaaccac
aaggctgacgctgtattgagcatgccgtcttccgtgacctctggcctccacgtgcagcct
gccctggctgtctccatggacttcagcacctatggggggctgctgccccagggcttcatc
cagagggagctgttcagcaagctgggggagctggctgtgggcatgaagtcagagagccgg
accatcggagagcagtgcagcgtgtgtggggtcgagcttcctgataacgaggctgtggag
cagcacaggaagctgcacagtgggatgaagacgtacgggtgcgagctctgcgggaagcgg
ttcctggatagtttgcggctgagaatgcacttactggctcattcagcgggtgccaaagcc
tttgtctgtgatcagtgcggtgcacagttttcgaaggaggatgccctggagacacacagg
cagacccatactggcactgacatggccgtcttctgtctgctgtgtgggaagcgcttccag
gcgcagagcgcactgcagcagcacatggaggtccacgcgggcgtgcgcagctacatctgc
agtgagtgcaaccgcaccttccccagccacacggctctcaaacgccacctgcgctcacat
acaggcgaccacccctacgagtgtgagttctgtggcagctgcttccgggatgagagcaca
ctcaagagccacaaacgcatccacacgggtgagaaaccctacgagtgcaatggctgtggc
aagaagttcagcctcaagcatcagctggagacgcactatagggtgcacacaggtgagaag
ccctttgagtgtaagctctgccaccagcgctcccgggactactcggccatgatcaagcac
ctgagaacgcacaacggcgcctcgccctaccagtgcaccatctgcacagagtactgcccc
agcctctcctccatgcagaagcacatgaagggccacaagcccgaggagatcccgcccgac
tggaggatagagaagacgtacctctacctgtgctatgtgtga

DBGET integrated database retrieval system