KEGG   Homo sapiens (human): 814Help
Entry
814               CDS       T01001                                 

Gene name
CAMK4, CaMK_IV, CaMK-GR, CaMKIV, caMK
Definition
(RefSeq) calcium/calmodulin dependent protein kinase IV
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04211  Longevity regulating pathway
hsa04371  Apelin signaling pathway
hsa04380  Osteoclast differentiation
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05214  Glioma
Network
nt06220  Calcium signaling
nt06273  Glioma
nt06316  Angiotensin-aldosterone signaling
  Element
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    814 (CAMK4)
   04020 Calcium signaling pathway
    814 (CAMK4)
   04024 cAMP signaling pathway
    814 (CAMK4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    814 (CAMK4)
   04925 Aldosterone synthesis and secretion
    814 (CAMK4)
  09156 Nervous system
   04725 Cholinergic synapse
    814 (CAMK4)
   04720 Long-term potentiation
    814 (CAMK4)
   04722 Neurotrophin signaling pathway
    814 (CAMK4)
  09158 Development
   04380 Osteoclast differentiation
    814 (CAMK4)
  09149 Aging
   04211 Longevity regulating pathway
    814 (CAMK4)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    814 (CAMK4)
  09165 Substance dependence
   05031 Amphetamine addiction
    814 (CAMK4)
   05034 Alcoholism
    814 (CAMK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    814 (CAMK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     814 (CAMK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   814 (CAMK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo Pkinase_fungal DUF1103 APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 814
NCBI-ProteinID: NP_001310303
OMIM: 114080
HGNC: 1464
Ensembl: ENSG00000152495
Vega: OTTHUMG00000128792
Pharos: Q16566(Tbio)
UniProt: Q16566
LinkDB All DBs
Structure
PDB: 

Position
5q22.1
AA seq 473 aa AA seqDB search
MLKVTVPSCSASSCSSVTASAAPGTASLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSSHGSIQESHKASRDPS
PIQDGNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKA
VEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgctcttcggtcaccgccagt
gcggccccggggaccgcgagcctcgtcccggattactggatcgacggctccaacagggat
gcgctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtaagaactgagataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagaactgtttgataggattgtggaaaagggatattacagtgagcgagat
gctgcagatgccgttaaacaaatcctggaggcagttgcttatctacatgaaaatgggatt
gtccatcgtgatctcaaaccagagaatcttctttatgcaactccagccccagatgcacca
ctcaaaatcgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgcacctgaaattcttagaggttgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctacatcttactttgtggatttgaacca
ttctatgatgaaagaggcgatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccctggtgggatgaagtatctctaaatgccaaggacttggtcagaaaatta
attgttttggatccaaagaaacggctgactacatttcaagctctccagcatccgtgggtc
acaggtaaagcagccaattttgtacacatggataccgctcaaaagaagctccaagaattc
aatgcccggcgtaagcttaaggcagcggtgaaggctgtggtggcctcttcgcgcctggga
agtgccagcagcagccatggcagcatccaggagagccacaaggctagccgagacccttct
ccaatccaagatggcaacgaggacatgaaagctattccagaaggagagaaaattcaaggc
gatggggcccaagccgcagttaagggggcacaggctgagctgatgaaggtgcaagcctta
gagaaagttaaaggtgcagatataaatgctgaagaggcccccaaaatggtgcccaaggca
gtggaggatgggataaaggtggctgacctggaactagaggagggcctagcagaggagaag
ctgaagactgtggaggaggcagcagctcccagagaagggcaaggaagctctgctgtgggt
tttgaagttccacagcaagatgtgatcctgccagagtactaa

DBGET integrated database retrieval system