KEGG   Homo sapiens (human): 8536Help
Entry
8536              CDS       T01001                                 

Gene name
CAMK1, CAMKI
Definition
(RefSeq) calcium/calmodulin dependent protein kinase I
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa05214  Glioma
Network
nt06220  Calcium signaling
nt06273  Glioma
nt06316  Angiotensin-aldosterone signaling
  Element
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    8536 (CAMK1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    8536 (CAMK1)
   04925 Aldosterone synthesis and secretion
    8536 (CAMK1)
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    8536 (CAMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8536 (CAMK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     8536 (CAMK1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   8536 (CAMK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo APH RIO1 Tyrosinase
Motif
Other DBs
NCBI-GeneID: 8536
NCBI-ProteinID: NP_003647
OMIM: 604998
HGNC: 1459
Ensembl: ENSG00000134072
Vega: OTTHUMG00000128419
Pharos: Q14012(Tchem)
UniProt: Q14012 B0YIY3
LinkDB All DBs
Structure
PDB: 

Position
3p25.3
AA seq 370 aa AA seqDB search
MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEALEGKE
GSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGFYTERDASR
LIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVLSTACG
TPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSP
YWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTALDKNIHQSVSEQIKKNFAK
SKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTPVAGGPAAGCCCRDCCVEPGT
ELSPTLPHQL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctgggggcagtggaaggccccaggtggaagcaggcggaggacattagagacatctac
gacttccgagatgttctgggcacgggggccttctcggaggtgatcctggcagaagataag
aggacgcagaagctggtggccatcaaatgcattgccaaggaggccctggagggcaaggaa
ggcagcatggagaatgagattgctgtcctgcacaagatcaagcaccccaacattgtagcc
ctggatgacatctatgagagtgggggccacctctacctcatcatgcagctggtgtcgggt
ggggagctctttgaccgtattgtggaaaaaggcttctacacggagcgggacgccagccgc
ctcatcttccaggtgctggatgctgtgaaatacctgcatgacctgggcattgtacaccgg
gatctcaagccagagaatctgctgtactacagcctggatgaagactccaaaatcatgatc
tccgactttggcctctccaagatggaggacccgggcagtgtgctctccaccgcctgtgga
actccgggatacgtggcccctgaagtcctggcccagaagccctacagcaaggctgtggat
tgctggtccataggtgtcatcgcctacatcttgctctgcggttaccctcccttctatgac
gagaatgatgccaaactctttgaacagattttgaaggccgagtacgagtttgactctcct
tactgggacgacatctctgactctgccaaagatttcatccggcacttgatggagaaggac
ccagagaaaagattcacctgtgagcaggccttgcagcacccatggattgcaggagataca
gctctagataagaatatccaccagtcggtgagtgagcagatcaagaagaactttgccaag
agcaagtggaagcaagccttcaatgccacggctgtggtgcggcacatgaggaaactgcag
ctgggcaccagccaggaggggcaggggcagacggcgagccatggggagctgctgacacca
gtggctggggggccggcagctggctgttgctgtcgagactgctgcgtggagccgggcaca
gaactgtcccccacactgccccaccagctctag

DBGET integrated database retrieval system