KEGG   Homo sapiens (human): 8924
Entry
8924              CDS       T01001                                 

Gene name
HERC2, D15F37S1, MRT38, SHEP1, jdf2, p528
Definition
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase 2
  KO
K10595  E3 ubiquitin-protein ligase HERC2 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8924 (HERC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8924 (HERC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8924 (HERC2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8924 (HERC2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     8924 (HERC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   8924 (HERC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    8924 (HERC2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     8924 (HERC2)
SSDB
Motif
Pfam: RCC1 RCC1_2 HECT Cul7 MIB_HERC2 Cyt-b5 ZZ SH3_15 ANAPC10
Other DBs
NCBI-GeneID: 8924
NCBI-ProteinID: NP_004658
OMIM: 605837
HGNC: 4868
Ensembl: ENSG00000128731
Vega: OTTHUMG00000129251
Pharos: O95714(Tbio)
UniProt: O95714 A8KAQ8
LinkDB
Structure
PDB: 
3KCI 4L1M

Position
15q13.1
AA seq 4834 aa
MPSESFCLAAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPP
RKDDSVEPSGTKKEDLNDKEKKDEEETPAPIYRAKSILDSWVWGKQPDVNELKECLSVLV
KEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKK
SSRPAGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASL
FDESTVSSVWLEVVERATRFLRSVVTGDVHGTPATKGPGSIPLQDQHLALAILLELAVQR
GTLSQMLSAILLLLQLWDSGAQETDNERSAQGTSAPLLPLLQRFQSIICRKDAPHSEGDM
HLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVMAHLDRLATPCMPPLCSSPTSHKG
SLQEVIGWGLIGWKYYANVIGPIQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSD
TLAPQLVQGLASRNIVKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKV
ISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGL
KGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVV
KVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTH
CLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCS
EWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQL
HAAISHQVDPEFLGLGLGSILLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGWSVLLPT
AEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIE
AKKEAQKEKEIDEQEANASTFHRSRTPLDKDLINTGICESSGKQCLPLVQLIQQLLRNIA
SQTVARLKDVARRISSCLDFEQHSRERSASLDLLLRFQRLLISKLYPGESIGQTSDISSP
ELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVAYIVEGDFTGVLLPELVVS
IVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQN
CRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVA
LEAALQFEDTRESMHAFCVGQYLEPDQEIVTIPDLGSLSSPLIDTERNLGLLLGLHASYL
AMSTPLSPVEIECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSH
RRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPIMFPPEHPVEEVGRLL
LCCLLKHEDLGHVALSLVHAGALGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQGR
SYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVP
KKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYK
WLKQNVQGLYPQSPLLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLAS
KNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAV
QNIRNVLMDASAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGAN
NLDLLLNSGMLALTQTALRLIGPSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSG
PELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGK
EGKYDLKLAELPAAAQPSAEDSDTEDDSEAEQTERNIHPTAMMFTSTINLLQTLCLSAGV
HAEIMQSEATKTLCGLLRMLVESGTTDKTSSPNRLVYREQHRSWCTLGFVRSIALTPQVC
GALSSPQWITLLMKVVEGHAPFTATSLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKL
FDFLGSLLTTCSSDVPLLRESTLRRRRVRPQASLTATHSSTLAEEVVALLRTLHSLTQWN
GLINKYINSQLRSITHSFVGRPSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLG
GQVMHDEFGEGTVTRITPKGKITVQFSDMRTCRVCPLNQLKPLPAVAFNVNNLPFTEPML
SVWAQLVNLAGSKLEKHKIKKSTKQAFAGQVDLDLLRCQQLKLYILKAGRALLSHQDKLR
QILSQPAVQETGTVHTDDGAVVSPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDK
QELEAAALAVCQCLAVESTHPSSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALP
IVVQLMEMGFSRRNIEFALKSLTGASGNASSLPGVEALVGWLLDHSDIQVTELSDADTVS
DEYSDEEVVEDVDDAAYSMSTGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCC
RAYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIK
IGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVP
SIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNTRHTFGRINEPGQSAVFC
GRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWI
RLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTTVPLLND
CTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNS
GSLIRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGG
SKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHAT
ALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGEL
YTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDG
DFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHG
SDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKP
TLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADS
SAASNKISGASNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVVGALMPA
AMIAPVECPSFSSAAPSDASAMASPMNGEECMLAVDIEDRLSPNPWQEKREIVSSEDAVT
PSAVTPSAPSASARPFIPVTDDLGAASIIAETMTKTKEDVESQNKAAGPEPQALDEFTSL
LIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVAT
DSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTVMDG
VNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLS
DRCVLSCPSMDLVTCLLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRK
LLTTEFGQSININRLLGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQ
LLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDE
VAKKIRELMADSENMDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHN
HRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIG
GTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCD
RPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEAL
QGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVV
KVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLH
CVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSK
PASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGP
SVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGT
KSVFGQMCAKMSSFGPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPL
LIVTPNGRDESGANRDCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWK
QLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHT
HITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDI
PLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRD
FVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIA
LTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH
NT seq 14505 nt   +upstreamnt  +downstreamnt
atgccctctgaatctttctgtttggctgcccaggctcgcctcgactccaaatggttgaaa
acagatatacagcttgcattcacaagagatgggctctgtggtctgtggaatgaaatggtt
aaagatggagaaattgtatacactggaacagaatcaacccagaacggagagctccctcct
agaaaagatgatagtgtcgaaccaagtggaacaaagaaagaagatctgaatgacaaagag
aaaaaagatgaagaagaaactcctgcacctatatatagggccaagtcaattctggacagc
tgggtatggggcaagcaaccagatgtgaatgaactgaaggagtgtctttctgtgctggtt
aaagagcagcaggccctggccgtccagtcagccaccaccaccctctcagccctgcgactc
aagcagaggctggtgatcttggagcgctatttcattgccttgaatagaaccgtttttcag
gagaatgtcaaagttaagtggaaaagcagcggtatttctctgcctcctgtggacaaaaaa
agttcccggcctgcgggcaaaggtgtggaggggctcgccagagtgggatcccgagcggcg
ctgtcttttgcctttgccttcctgcgcagggcctggcgatcaggcgaggatgcggacctc
tgcagtgagctgttgcaggagtccctggacgccctgcgagcacttcccgaggcctcgctc
tttgacgagagcaccgtgtcctctgtgtggctggaggtggtggagagagcgaccaggttc
ctcaggtccgtcgtgacgggggatgttcacggaacgccagccaccaaagggccaggaagc
atccccctgcaggaccagcacttggccctggccatcctgctggagctggctgtgcagaga
ggcacgctgagccaaatgttgtctgccatcctgttgttgcttcagctgtgggacagcggg
gcacaggagactgacaatgagcgttccgcccagggcaccagcgccccacttttgcccttg
ctgcaaaggttccagagcatcatttgcaggaaggatgcaccccactccgagggcgacatg
caccttttgtctggccctctgagccccaatgagagtttcctgaggtacctcacccttcca
caagacaacgagcttgccattgatctgcgacaaacggcggttgttgtcatggcccattta
gaccgtctggctacgccctgtatgcctccgctgtgtagctctccgacatctcataaggga
tcattgcaagaggtcataggttgggggttaataggatggaaatactatgccaatgtgatt
ggtccaatccagtgcgaaggcctggccaacctgggagtcacacagattgcctgtgcagag
aagcgtttcctgattctgtcacgcaatggccgcgtgtacacacaggcctataatagtgac
acgctggccccacagctggtccaaggccttgcctccagaaacattgtaaaaattgctgcc
cattctgatggtcaccactacctagccttggctgctactggagaggtgtactcctggggc
tgtggggacggcggacggctgggccatggggacactgtgcctttggaggagcctaaggtg
atctccgccttctctggaaagcaggccgggaagcacgtggtgcacatcgcttgcgggagc
acttacagtgcggccatcactgccgagggggagctgtacacctggggccgcgggaactac
ggccggctgggccatggctccagtgaggacgaggccattccgatgctggtagccgggctt
aaaggactgaaggtcatcgatgtggcgtgtgggagtggggatgctcaaaccctggctgtc
actgagaacgggcaagtgtggtcttggggagatggtgactatgggaaattgggcagaggt
ggtagtgatggctgcaaaaccccaaagctgattgaaaagcttcaagacttggatgtggtc
aaagtccgctgtggaagtcagttttccattgctttgacgaaagatggccaagtttattca
tggggaaaaggtgacaaccagagacttggacatggaacagaggaacatgttcgttatcca
aaactcttagaaggcttgcaagggaagaaggtgattgatgtggctgcaggctccacccac
tgcctggctctgactgaggacagcgaggtccacagctgggggagcaacgaccagtgccag
cactttgacaccttgcgcgtgaccaagccagaacctgcagcattgccaggactggacacc
aaacacatagtgggaattgcctgtgggcctgcccagagctttgcttggtcatcatgttct
gagtggtccattggcctccgtgtcccttttgtggtggacatctgctcaatgacttttgag
cagctggatctcctgcttcggcaggtgagtgaggggatggatggttccgcggactggccc
ccgccccaggagaaagagtgtgtggccgtggcaacgctgaatcttctacgacttcagttg
catgctgccattagtcaccaggttgacccggaattccttggtttaggtctgggcagcatc
ctcctgaacagcctgaagcagacggtggtgaccctggccagcagtgcgggcgtgctgagc
accgtgcagtcggccgcccaggccgtgctgcagagtggctggtccgtgctgctgcccacc
gcggaggagcgggcccgggcactctctgctctcctgccctgcgcagtttcaggcaatgaa
gtgaacataagtccaggtcgtcgattcatgattgatcttctggtgggcagcttgatggct
gatggagggttggagtcagccttacacgcagccattactgcagagatccaggatattgaa
gccaaaaaagaagcacagaaggaaaaagaaattgatgaacaggaagcgaatgcctcaaca
tttcatagaagcaggactccactggataaagaccttattaatacggggatctgtgagtct
tctggcaaacagtgtttgcctctggttcagctcatacaacagcttcttagaaacattgct
tctcagactgtagccagattgaaagatgttgcccgtcggatttcatcatgtctggacttt
gagcaacacagtcgtgaaagatctgcttcattggatttgttactgcgttttcaacgtttg
cttattagtaaactttatccaggagaaagtattggtcagacctcagatatttctagtcca
gagctaatgggtgttggttccttgctgaagaagtacacagccctcctgtgcacgcacatt
ggagatatactgcctgtggccgccagcattgcttctaccagctggcggcacttcgcggag
gtggcttacattgtggaaggggactttactggtgttctccttccagaactagtagtttct
atagtgcttctgctcagtaaaaatgctggtctcatgcaagaggctggagctgtacctctg
ctgggtggcctgttggaacatctggatcggttcaaccatctggcaccaggaaaggaacgg
gatgatcatgaagagttagcctggcctggcataatggagtcattttttacaggtcagaac
tgtagaaataatgaggaagtgacacttatacgcaaagctgatttggagaaccataataaa
gatggaggcttctggactgtgattgacgggaaggtgtatgatataaaggacttccagaca
cagtcgttaacaggaaatagtattcttgctcagtttgcaggggaagacccagtggtagct
ttggaagctgctttgcagtttgaagacacccgggaatccatgcacgcgttttgtgttggc
cagtatttggagcctgaccaagaaatcgtcaccataccagatctggggagtctctcttca
cctctgatagacacagagaggaatctgggcctgcttctcggattacacgcttcgtatttg
gcaatgagcacaccgctgtctcctgtcgagattgaatgtgccaaatggcttcagtcatcc
atcttctctggaggcctgcagaccagccagatccactacagctacaacgaggagaaagac
gaggaccactgcagctccccagggggcacacctgccagcaaatctcgactctgctcccac
agacgggccctgggggaccattcccaggcatttctgcaagccattgcagacaacaacatt
caggatcacaacgtgaaggactttttgtgtcaaatagaaaggtactgtaggcagtgccat
ttgaccacaccgatcatgtttccccccgagcatcccgtggaagaggtcggtcgcttgttg
ttatgttgcctcttaaaacatgaagatttaggtcatgtggcattatctttagttcatgca
ggtgcacttggtattgagcaagtaaagcacagaacgttgcctaagtcagtggtggatgtt
tgtagagttgtctaccaagcaaaatgttcgctcattaagactcatcaagaacagggccgt
tcttacaaggaggtctgcgctcctgtcatcgaacgtttgagattcctctttaatgaattg
agacctgctgtttgtaatgacctctctataatgtctaagtttaaattgttaagttctttg
ccccgttggaggaggatagctcaaaagataattcgagaacgaaggaaaaagagagttcct
aagaagccagaatctacggatgatgaagaaaaaattggaaacgaagagagtgatttagaa
gaagcttgcattttgcctcatagtccaataaatgtggacaagagacccattgcaattaaa
tcacccaaggacaaatggcagccgctgttgagtactgttacaggtgttcacaaatacaag
tggttgaagcagaatgtgcagggtctttatccgcagtctccactcctcagtacaattgct
gaatttgcccttaaagaagagccagtggatgtggaaaaaatgagaaagtgcctactaaaa
cagttggagagagcagaggttcgcctggaagggatagatacaattttaaaactggcgagc
aagaatttcttacttccatctgtgcagtatgcgatgttttgtggatggcaaagacttatt
cctgagggaatcgatataggggaacctcttactgattgtttaaaggatgttgatttgatc
ccgccttttaatcggatgctgctggaagtcacctttggcaagctgtacgcttgggctgta
cagaacattcgaaatgttttgatggatgccagtgccaaatttaaagagcttggtatccag
ccggttcccctgcaaaccatcaccaatgagaacccgtcaggaccgagcctggggaccatc
ccgcaagcccgcttcctcctggtgatgctcagcatgctcaccctgcagcacggcgcaaac
aacctcgaccttctgctcaattccggcatgctggccctcacgcagacggcactgcgcctg
attggccccagttgtgacaacgttgaggaagatatgaatgcttctgctcaaggtgcttct
gccacagttttggaagaaacaaggaaggaaacggctcctgtgcagctccctgtttcagga
ccagaactggctgccatgatgaagattggaacaagggtcatgagaggtgtggactggaaa
tggggcgatcaggatgggcctcctccaggcctaggccgcgtgattggtgagctgggagag
gacggatggataagagtccagtgggacacaggcagcaccaactcctacaggatggggaaa
gaaggaaaatacgacctcaagctggcagagctgccggctgctgcacagccctcagcagag
gattcggacacagaggatgactctgaagccgaacaaactgaaaggaacattcaccccact
gcaatgatgtttaccagcactattaacttactgcagactctttgtctgtctgctggagtt
catgctgagatcatgcagagcgaagccaccaagactttatgcggactgctgcgaatgtta
gtggaaagcggaacgacggacaagacatcttctccaaacaggctggtgtacagggagcaa
caccggagctggtgcacgctggggtttgtgcggagcatcgctctcacgccgcaggtatgc
ggcgccctcagctccccgcagtggatcacgctgctcatgaaggtcgtggaagggcacgca
cccttcactgccacctcgctgcagaggcagatcttagctgtgcatttgttgcaagcagtc
cttccatcatgggacaagaccgaaagggcgagggacatgaaatgcctcgtggagaagctg
tttgacttcttgggaagcttgctcactacctgctcctctgacgtgccattactcagagag
tccacgctgaggcggcgcagggtgcgcccgcaggcctcgctgactgccacccacagcagc
acactggcggaggaggtggtggcactgctgcgcacgctgcactccctgactcagtggaat
gggctcatcaacaagtacatcaactcccagctccgctccatcacccacagctttgtggga
aggccttccgaaggggcccagttagaggactacttccccgactccgagaaccctgaagtg
gggggcctcatggcagtcctggctgtgattggaggcatcgatggtcgcctgcgcctgggc
ggtcaagttatgcacgatgagtttggagaaggcactgtgactcgcatcaccccaaagggc
aaaatcaccgtgcagttctctgacatgcggacgtgtcgcgtttgcccattgaatcagctg
aaaccactccctgccgtggcctttaatgtgaacaacctgcccttcacagagcccatgctg
tctgtctgggctcagttggtgaacctcgctggaagcaagttagaaaagcacaaaataaag
aaatcgactaaacaggcctttgcaggacaagtggacctggacctgctgcggtgccagcag
ttgaagctatacatcctgaaagcaggtcgggcgctgctctcccaccaggataaactgcgg
cagatcctgtctcagccagctgttcaggagactggaactgttcacacagatgatggagca
gtggtatcacctgaccttggggacatgtctcctgaagggccgcagccccccatgatcctc
ttgcagcagctgctggcctcggccacccagccgtctcctgtgaaggccatatttgataaa
caggaacttgaggctgctgcactggccgtttgccagtgcttggctgtggagtccactcac
ccttcgagcccaggatttgaagactgcagctccagtgaggccaccacgcctgtcgccgtg
cagcacatccgccctgccagagtgaagaggcgcaagcagtcgcccgttcccgctctgccg
atcgtggtgcagctcatggagatgggattttccagaaggaacatcgagtttgccctgaag
tctctcactggtgcttccgggaatgcatccagcttgcctggtgtggaagccttggtcggg
tggctgctggaccactccgacatacaggtcacggagctctcagatgcagacacggtgtcc
gacgagtattctgacgaggaggtggtggaggacgtggatgatgccgcctactccatgtct
actggtgctgttgtgacggagagccagacgtacaaaaaacgagctgatttcttgagtaat
gatgattatgctgtatatgtgagagagaatattcaggtgggaatgatggttagatgctgc
cgagcgtatgaagaagtgtgcgaaggtgatgttggcaaagtcatcaagctggacagagat
ggattgcatgatctcaatgtgcagtgtgactggcagcagaaagggggcacctactgggtt
aggtacattcatgtggaacttataggctatcctccaccaagttcttcttctcacatcaag
attggtgataaagtgcgggtcaaagcctctgtcaccacaccaaaatacaaatggggatct
gtgactcatcagagtgtgggggttgtgaaagctttcagtgccaatggaaaagatatcatt
gtcgactttccccagcagtctcactggactgggttgctatcagaaatggagttggtaccc
agtattcatcctggggttacgtgtgatggatgtcagatgtttcctatcaatggatccaga
ttcaaatgcagaaactgtgatgactttgatttttgtgaaacgtgtttcaagaccaaaaaa
cacaataccaggcatacatttggcagaataaatgaaccaggtcagtctgcggtattttgt
ggccgttctggaaaacagctgaagcgttgccacagcagccagccaggcatgctgctggac
agctggtcccgcatggtgaagagcctgaatgtgtcgtcctccgtgaaccaggcatcccgt
ctcattgacggcagcgagccctgctggcagtcatcggggtcgcaaggaaagcactggatt
cgtttggagattttcccagatgttcttgttcatagattaaaaatgatcgtagatcctgct
gacagtagctacatgccgtccctggttgtagtgtcaggtggaaattccctgaataacctt
attgaactaaagacaatcaatattaacccttctgacaccacagtgccccttctgaatgac
tgcacagagtatcacaggtatattgaaattgctataaagcagtgcaggagctcaggaatc
gattgtaaaatccatggtctcatcctgctgggacggatccgtgcagaagaggaagatttg
gctgcagttcctttcttagcttcggataatgaagaggaggaggatgagaaaggcaacagc
ggaagcctcattagaaagaaggctgctgggctggaatcagcagctacgataagaaccaag
gtgtttgtgtggggcctgaatgacaaggaccagctgggcgggctgaaaggctccaagata
aaggttccttcgttctctgagacactgtcagctttgaatgtggtacaggtggctggtgga
tctaaaagtttgtttgcagtgactgtggaagggaaggtgtatgcctgtggagaagccacg
aatggccggctggggctgggcatttccagcgggacggtgcccatcccacggcagatcaca
gctctcagcagctacgtggtcaagaaggtggctgttcactcaggtggccggcacgcgacg
gctttaactgtcgatggaaaagtgttttcgtggggcgaaggtgacgatggaaaacttgga
cacttcagcagaatgaactgtgacaaaccaaggctgatcgaggccctgaaaaccaagcgt
atccgggatatcgcctgtgggagctcgcacagcgcagccctcacatccagcggagaactg
tacacctggggcctcggcgagtacggccggctgggacatggggataatacgacacagcta
aagcccaaaatggtgaaagtccttctcggtcacagagtaatccaggttgcatgtgggagt
agagacgcgcagaccctggctctgaccgatgaaggtttggtattttcctggggtgatggt
gactttggaaaactgggccggggcggaagtgaaggctgtaacattccccagaacattgag
agactaaatggacagggggtgtgccagattgagtgtggagctcagttctccctggcgctc
accaagtctggagtggtgtggacatggggaaagggggattacttcagattgggccacggc
tctgacgtgcacgtgcggaaaccacaggtggtggaagggctgagagggaagaagatcgtg
catgtggctgtcggggccctgcactgcctggcggtcacggactcggggcaggtgtatgct
tggggtgacaacgaccacggccagcagggcaatggcacgaccacggttaacaggaagccc
acactcgtgcaaggcttagaaggccagaagatcacacgcgtggcttgtgggtcgtcccac
agtgtggcgtggacaactgtggatgtggccacgccctctgtccacgagcccgtcctcttc
cagactgcaagagaccctttaggtgcttcctatttaggcgtgccttcagatgctgattct
tctgctgccagtaataaaataagtggtgcaagtaattctaagccaaatcgcccttctctt
gccaagattctcttgtcattggatggaaatctggccaaacagcaggccttatcacatatt
cttacagcattgcaaatcatgtatgccagagatgctgttgtcggggccctgatgccggcc
gccatgatcgccccggtggagtgcccctcgttctcctcggcggccccttccgacgcatct
gcgatggctagtcccatgaatggagaagaatgcatgctggctgttgatatcgaagacaga
ctgagtccaaatccatggcaagaaaagagagagattgtttcctctgaggacgcagtgacc
ccctctgcagtgactccgtcggccccctcagcctccgctcggccttttatcccagtgacg
gatgacctgggagccgcaagcatcattgcagaaaccatgaccaaaaccaaagaggatgtt
gaaagccaaaataaagcagcaggtccggagcctcaggccttggatgagttcaccagtctg
ctgattgcggatgacactcgtgtggtggtagacctgctcaagctgtcagtgtgcagccgg
gccggggacaggggcagggatgtgctctccgcggtgctttccggcatggggaccgcctac
ccacaggtggcagatatgctgttggagctctgtgtcaccgagttggaggatgtggccaca
gactcgcagagcggccgcctctcttctcagcctgtggtggtggagagtagccacccttac
accgacgacacctccaccagtggcacagtgaagataccaggtgcagaaggactcagggta
gaatttgaccggcagtgctccacagagaggcgccacgaccctctcacagtcatggacggc
gtcaacaggatcgtctccgtgcggtcaggccgagagtggtccgactggtccagcgagctg
cgcatcccaggggatgagttaaagtggaagttcatcagcgatgggtctgtgaatggctgg
ggctggcgcttcaccgtctatcccatcatgccagctgctggccctaaagaactcctctct
gaccgctgcgtcctctcctgtccatccatggacttggtgacgtgtctgttagacttccga
ctcaaccttgcctctaacagaagcatcgtccctcgccttgcggcctcgctggcagcttgt
gcacagctgagtgccctagctgccagtcacagaatgtgggcccttcagagactgaggaag
ctgcttacaactgaatttgggcagtcaattaacataaataggctgcttggagaaaatgat
ggggaaacaagagctttgagttttacaggtagtgctcttgctgctttggtgaaaggtctt
ccagaagctttgcaaaggcagtttgaatatgaagatcctattgtgaggggtggcaaacag
ctgctccacagcccattctttaaggtactggtagctcttgcttgtgacctggagctggac
actctgccttgctgtgccgagacgcacaagtgggcctggttccggaggtactgcatggcc
tcccgtgttgctgtggcccttgacaaaagaacaccgttgccccgtctgtttcttgatgag
gtggctaagaaaattcgtgaattaatggcagacagcgaaaacatggatgttctgcatgag
agccatgacatttttaaaagagagcaagacgaacaacttgtgcagtggatgaacaggcga
ccagatgactggactctctctgctggtggcagtggaacaatttatggatggggacataat
cacaggggccagctcgggggcattgaaggcgcaaaagtcaaagttcccactccctgtgaa
gcccttgcaactctcagacccgtgcagttaatcggaggggaacagaccctctttgctgtg
acggctgatgggaagctgtatgccactgggtatggtgcaggtggcagactaggcattgga
gggacagagtcggtgtccaccccaacattgcttgaatccattcagcatgtgtttattaag
aaagtagctgtgaactctggaggaaagcactgccttgccctgtcttcagaaggagaagtt
tactcttggggtgaggcagaagatgggaagttggggcatggcaacagaagtccgtgtgac
cgccctcgtgtcatcgagtctctgagaggaattgaagtggtcgatgttgctgctggcgga
gcccacagcgcctgtgtcacagcagccggggacctctacacatggggcaaaggccgctac
ggccggctggggcacagcgacagtgaggaccagctgaagccgaagctggtggaggcgctg
cagggccaccgtgtggttgacatcgcctgtggcagtggagatgcccagaccctctgcctc
acagatgacgacactgtctggtcctggggggacggggactacggcaagctcggccgggga
ggcagcgatggctgtaaagtgcctatgaagattgattctcttactggtcttggagtagtt
aaagtggaatgcggatcccagttttctgttgcccttaccaaatctggagctgtttatacc
tggggcaaaggcgattatcacaggttgggccatggatcagatgaccatgttcgaaggcct
cggcaggtccaagggttgcaggggaagaaagtcatcgccatcgccactggctccctgcac
tgtgtgtgctgcacagaggatggtgaggtttatacatggggcgacaatgatgagggacaa
ctgggagacggaaccaccaatgccatccagaggcctcggttggtagctgcccttcagggt
aagaaggtcaaccgtgtggcctgtggctcagcacataccctcgcctggtcgaccagcaag
cccgccagtgctggcaaactccctgcacaggtccccatggagtacaatcacctgcaggag
atccccatcattgcgctgaggaaccgtctgctgctgctgcaccacctctccgagctcttc
tgcccctgcatccccatgttcgacctggaaggctcgctcgacgaaactggactcgggcct
tctgttgggttcgacactctccgaggaattctgatatcccagggaaaggaggcggctttc
cggaaagtagtacaagcaactatggtacgcgatcgtcagcatggccccgtcgtggagctg
aaccgcatccaggtcaaacgatcaaggagcaaaggcgggctggccggccccgacggcacc
aagtctgtctttgggcagatgtgtgctaagatgagctcgtttggtcccgacagcctcctc
cttcctcaccgtgtctggaaagtcaagtttgtgggtgaatctgtggatgactgtgggggc
ggctacagcgagtccatagctgagatctgtgaggagctgcagaacggactcacgcccctg
ctgatcgtgacacccaacgggagggatgagtctggggccaaccgagactgctacctgctc
agcccggccgccagagcacccgtgcacagcagcatgttccgcttcctgggtgtgttgctg
ggcattgccatccgaaccgggagtcccctgagcctcaaccttgccgagcctgtctggaag
cagctggctgggatgagcctcaccatcgcggacctcagtgaggttgataaggattttatt
cctggactcatgtacatccgagacaatgaagccacctcagaggagtttgaagccatgagc
ctgcccttcacagtgccaagtgccagtggccaggacattcagttgagctccaagcacaca
cacatcaccctggacaaccgcgcggagtacgtgcggctggcgataaactatagactccat
gaatttgatgagcaggtggctgctgttcgggaaggaatggcccgcgttgtgcctgttccc
ctcctctctctgttcaccggctacgaactggagacgatggtgtgtggcagccctgacatc
ccgctgcaccttctcaagtcggtggccacctataaaggcatcgagccttccgcatcgctg
atccagtggttctgggaggtgatggagtccttctccaacacagagcgctctcttttcctt
cgcttcgtctggggccggacgaggctgcccaggaccatcgccgacttccggggccgagac
ttcgtcatccaggtgttggataaatacaaccctccagaccacttcctccctgagtcctac
acctgtttcttcttgctgaagctgcccaggtattcctgcaagcaggtgctggaggagaag
ctcaagtacgccatccacttctgcaagtccatagacacagatgactacgctcgcatcgca
cttacaggagagccagccgccgacgacagcagcgacgattcagataacgaggatgtcgac
tcctttgcttcggactctacacaagattatttaacaggacactaa

DBGET integrated database retrieval system