KEGG   Homo sapiens (human): 929Help
Entry
929               CDS       T01001                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04145  Phagosome
hsa04620  Toll-like receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Disease
H00079  Asthma
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    929 (CD14)
   04064 NF-kappa B signaling pathway
    929 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    929 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    929 (CD14)
   04620 Toll-like receptor signaling pathway
    929 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    929 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    929 (CD14)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    929 (CD14)
   05132 Salmonella infection
    929 (CD14)
   05133 Pertussis
    929 (CD14)
   05134 Legionellosis
    929 (CD14)
   05152 Tuberculosis
    929 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    929 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    929 (CD14)
   04090 CD molecules [BR:hsa04090]
    929 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    929 (CD14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   929 (CD14)
CD molecules [BR:hsa04090]
 Proteins
  929 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  929 (CD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 929
NCBI-ProteinID: NP_000582
OMIM: 158120
HGNC: 1628
Ensembl: ENSG00000170458
Vega: OTTHUMG00000129507
Pharos: P08571(Tbio)
UniProt: P08571
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 375 aa AA seqDB search
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccat
gccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccaca
ggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttgg
ctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaag
ttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcaga
gtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccac
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

KEGG   Homo sapiens (human): 3684Help
Entry
3684              CDS       T01001                                 

Gene name
ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
Definition
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules (CAMs)
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06136  Complement activation (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
N00463  Alternative pathway of complement activation
Drug target
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3684 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3684 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3684 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3684 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3684 (ITGAM)
   04610 Complement and coagulation cascades
    3684 (ITGAM)
   04670 Leukocyte transendothelial migration
    3684 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3684 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    3684 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3684 (ITGAM)
   05134 Legionellosis
    3684 (ITGAM)
   05150 Staphylococcus aureus infection
    3684 (ITGAM)
   05152 Tuberculosis
    3684 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3684 (ITGAM)
   05140 Leishmaniasis
    3684 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3684 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3684 (ITGAM)
   04515 Cell adhesion molecules [BR:hsa04515]
    3684 (ITGAM)
   04090 CD molecules [BR:hsa04090]
    3684 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3684 (ITGAM)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3684 (ITGAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3684 (ITGAM)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3684 (ITGAM)
CD molecules [BR:hsa04090]
 Proteins
  3684 (ITGAM)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Adhesion molecules of cell surface
   3684 (ITGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2
Motif
Other DBs
NCBI-GeneID: 3684
NCBI-ProteinID: NP_000623
OMIM: 120980
HGNC: 6149
Ensembl: ENSG00000169896
Vega: OTTHUMG00000176612
Pharos: P11215(Tbio)
UniProt: P11215
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 1152 aa AA seqDB search
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacttggac
actgaaaacgcaatgaccttccaagagaacgcaaggggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaagg
ggcagcctctaccagtgcgactacagcacaggctcatgcgagcccatccgcctgcaggtc
cccgtggaggccgtgaacatgtccctgggcctgtccctggcagccaccaccagcccccct
cagctgctggcctgtggtcccaccgtgcaccagacttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgtttggatccaacctacggcagcagccccagaagttcccagaggcc
ctccgagggtgtcctcaagaggatagtgacattgccttcttgattgatggctctggtagc
atcatcccacatgactttcggcggatgaaggagtttgtctcaactgtgatggagcaatta
aaaaagtccaaaaccttgttctctttgatgcagtactctgaagaattccggattcacttt
accttcaaagagttccagaacaaccctaacccaagatcactggtgaagccaataacgcag
ctgcttgggcggacacacacggccacgggcatccgcaaagtggtacgagagctgtttaac
atcaccaacggagcccgaaagaatgcctttaagatcctagttgtcatcacggatggagaa
aagtttggcgatcccttgggatatgaggatgtcatccctgaggcagacagagagggagtc
attcgctacgtcattggggtgggagatgccttccgcagtgagaaatcccgccaagagctt
aataccatcgcatccaagccgcctcgtgatcacgtgttccaggtgaataactttgaggct
ctgaagaccattcagaaccagcttcgggagaagatctttgcgatcgagggtactcagaca
ggaagtagcagctcctttgagcatgagatgtctcaggaaggcttcagcgctgccatcacc
tctaatggccccttgctgagcactgtggggagctatgactgggctggtggagtctttcta
tatacatcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaat
gatgcttacttgggttatgctgccgccatcatcttacggaaccgggtgcaaagcctggtt
ctgggggcacctcgatatcagcacatcggcctggtagcgatgttcaggcagaacactggc
atgtgggagtccaacgctaatgtcaagggcacccagatcggcgcctacttcggggcctcc
ctctgctccgtggacgtggacagcaacggcagcaccgacctggtcctcatcggggccccc
cattactacgagcagacccgagggggccaggtgtccgtgtgccccttgcccagggggagg
gctcggtggcagtgtgatgctgttctctacggggagcagggccaaccctggggccgcttt
ggggcagccctaacagtgctgggggacgtaaatggggacaagctgacggacgtggccatt
ggggccccaggagaggaggacaaccggggtgctgtttacctgtttcacggaacctcagga
tctggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctc
cagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ctgactgtaggagcccaggggcacgtgctgctgctcaggtcccagccagtactgagagtc
aaggcaatcatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgat
caggtggtgaaaggcaaggaagccggagaggtcagagtctgcctccatgtccagaagagc
acacgggatcggctaagagaaggacagatccagagtgttgtgacttatgacctggctctg
gactccggccgcccacattcccgcgccgtcttcaatgagacaaagaacagcacacgcaga
cagacacaggtcttggggctgacccagacttgtgagaccctgaaactacagttgccgaat
tgcatcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaacg
ccattgtctgctttcgggaacctccggccagtgctggcggaggatgctcagagactcttc
acagccttgtttccctttgagaagaattgtggcaatgacaacatctgccaggatgacctc
agcatcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttc
aacgtgacagtgactgtgagaaatgatggtgaggactcctacaggacacaggtcaccttc
ttcttcccgcttgacctgtcctaccggaaggtgtccacgctccagaaccagcgctcacag
cgatcctggcgcctggcctgtgagtctgcctcctccaccgaagtgtctggggccttgaag
agcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcacctttaat
atcacgtttgatgtagactctaaggcttcccttggaaacaaactgctcctcaaggccaat
gtgaccagtgagaacaacatgcccagaaccaacaaaaccgaattccaactggagctgccg
gtgaaatatgctgtctacatggtggtcaccagccatggggtctccactaaatatctcaac
ttcacggcctcagagaataccagtcgggtcatgcagcatcaatatcaggtcagcaacctg
gggcagaggagcctccccatcagcctggtgttcttggtgcccgtccggctgaaccagact
gtcatatgggaccgcccccaggtcaccttctccgagaacctctcgagtacgtgccacacc
aaggagcgcttgccctctcactccgactttctggctgagcttcggaaggcccccgtggtg
aactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatccag
gaagaattcaatgctaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctgatcgtgagcacagctgagatcttgtttaacgattccgtgttcacc
ctgctgccgggacagggggcgtttgtgaggtcccagacggagaccaaagtggagccgttc
gaggtccccaaccccctgccgctcatcgtgggcagctctgtcgggggactgctgctcctg
gccctcatcaccgccgcgctgtacaagctcggcttcttcaagcggcaatacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

KEGG   Homo sapiens (human): 2209Help
Entry
2209              CDS       T01001                                 

Gene name
FCGR1A, CD64, CD64A, FCRI, IGFR1
Definition
(RefSeq) Fc fragment of IgG receptor Ia
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2209 (FCGR1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2209 (FCGR1A)
   04666 Fc gamma R-mediated phagocytosis
    2209 (FCGR1A)
  09158 Development
   04380 Osteoclast differentiation
    2209 (FCGR1A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2209 (FCGR1A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    2209 (FCGR1A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2209 (FCGR1A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2209 (FCGR1A)
   05152 Tuberculosis
    2209 (FCGR1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2209 (FCGR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2209 (FCGR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2209 (FCGR1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2209 (FCGR1A)
CD molecules [BR:hsa04090]
 Proteins
  2209 (FCGR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 PIRT Adeno_E3_CR1 SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 2209
NCBI-ProteinID: NP_000557
OMIM: 146760
HGNC: 3613
Ensembl: ENSG00000150337
Vega: OTTHUMG00000012089
Pharos: P12314(Tchem)
UniProt: P12314
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 374 aa AA seqDB search
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcttgacaactctgctcctttgggttccagttgatgggcaagtggacaccaca
aaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaaccgtaacc
ttgcactgtgaggtgctccatctgcctgggagcagctctacacagtggtttctcaatggc
acagccactcagacctcgacccccagctacagaatcacctctgccagtgtcaatgacagt
ggtgaatacaggtgccagagaggtctctcagggcgaagtgaccccatacagctggaaatc
cacagaggctggctactactgcaggtctccagcagagtcttcacggaaggagaacctctg
gccttgaggtgtcatgcgtggaaggataagctggtgtacaatgtgctttactatcgaaat
ggcaaagcctttaagtttttccactggaattctaacctcaccattctgaaaaccaacata
agtcacaatggcacctaccattgctcaggcatgggaaagcatcgctacacatcagcagga
atatctgtcactgtgaaagagctatttccagctccagtgctgaatgcatctgtgacatcc
ccactcctggaggggaatctggtcaccctgagctgtgaaacaaagttgctcttgcagagg
cctggtttgcagctttacttctccttctacatgggcagcaagaccctgcgaggcaggaac
acatcctctgaataccaaatactaactgctagaagagaagactctgggttatactggtgc
gaggctgccacagaggatggaaatgtccttaagcgcagccctgagttggagcttcaagtg
cttggcctccagttaccaactcctgtctggtttcatgtccttttctatctggcagtggga
ataatgtttttagtgaacactgttctctgggtgacaatacgtaaagaactgaaaagaaag
aaaaagtgggatttagaaatctctttggattctggtcatgagaagaaggtaatttccagc
cttcaagaagacagacatttagaagaagagctgaaatgtcaggaacaaaaagaagaacag
ctgcaggaaggggtgcaccggaaggagccccagggggccacgtag

DBGET integrated database retrieval system