KEGG   Homo sapiens (human): 961Help
Entry
961               CDS       T01001                                 

Gene name
CD47, IAP, MER6, OA3
Definition
(RefSeq) CD47 molecule
  KO
K06266  CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    961 (CD47)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    961 (CD47)
   04090 CD molecules [BR:hsa04090]
    961 (CD47)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  CD47
   961 (CD47)
CD molecules [BR:hsa04090]
 Proteins
  961 (CD47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_CD47 CD47 V-set Ig_3 I-set Presenilin
Motif
Other DBs
NCBI-GeneID: 961
NCBI-ProteinID: NP_001768
OMIM: 601028
HGNC: 1682
Ensembl: ENSG00000196776
Vega: OTTHUMG00000044216
Pharos: Q08722(Tbio)
UniProt: Q08722
LinkDB All DBs
Structure
PDB: 

Position
3q13.12
AA seq 323 aa AA seqDB search
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLVITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRKAVEEPLNAFKESKGMMNDE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctggtagcggcgctgttgctgggctcggcgtgctgcggatcagctcagcta
ctatttaataaaacaaaatctgtagaattcacgttttgtaatgacactgtcgtcattcca
tgctttgttactaatatggaggcacaaaacactactgaagtatacgtaaagtggaaattt
aaaggaagagatatttacacctttgatggagctctaaacaagtccactgtccccactgac
tttagtagtgcaaaaattgaagtctcacaattactaaaaggagatgcctctttgaagatg
gataagagtgatgctgtctcacacacaggaaactacacttgtgaagtaacagaattaacc
agagaaggtgaaacgatcatcgagctaaaatatcgtgttgtttcatggttttctccaaat
gaaaatattcttattgttattttcccaatttttgctatactcctgttctggggacagttt
ggtattaaaacacttaaatatagatccggtggtatggatgagaaaacaattgctttactt
gttgctggactagtgatcactgtcattgtcattgttggagccattcttttcgtcccaggt
gaatattcattaaagaatgctactggccttggtttaattgtgacttctacagggatatta
atattacttcactactatgtgtttagtacagcgattggattaacctccttcgtcattgcc
atattggttattcaggtgatagcctatatcctcgctgtggttggactgagtctctgtatt
gcggcgtgtataccaatgcatggccctcttctgatttcaggtttgagtatcttagctcta
gcacaattacttggactagtttatatgaaatttgtggcttccaatcagaagactatacaa
cctcctaggaaagctgtagaggaaccccttaatgcattcaaagaatcaaaaggaatgatg
aatgatgaataa

DBGET integrated database retrieval system