KEGG   Homo sapiens (human): 9636
Entry
9636              CDS       T01001                                 

Gene name
ISG15, G1P2, IFI15, IMD38, IP17, UCRP, hUCRP
Definition
(RefSeq) ISG15 ubiquitin like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06133  RLR signaling (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01309  SARS-CoV-2 nsp3 to MDA5-IRF7/3 signaling pathway
N01320  SARS-CoV-2 nsp3 to RIG-I-IRF7/3 signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    9636 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    9636 (ISG15)
   05169 Epstein-Barr virus infection
    9636 (ISG15)
   05165 Human papillomavirus infection
    9636 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9636 (ISG15)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9636 (ISG15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 9636
NCBI-ProteinID: NP_005092
OMIM: 147571
HGNC: 4053
Ensembl: ENSG00000187608
Vega: OTTHUMG00000040777
Pharos: P05161(Tbio)
UniProt: P05161
LinkDB
Structure
PDB: 

Position
1p36.33
AA seq 165 aa
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
NT seq 498 nt   +upstreamnt  +downstreamnt
atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc
agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt
gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa
cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg
acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcggagctaa

DBGET integrated database retrieval system