KEGG   Homo sapiens (human): 9636Help
Entry
9636              CDS       T01001                                 

Gene name
ISG15, G1P2, IFI15, IMD38, IP17, UCRP, hUCRP
Definition
(RefSeq) ISG15 ubiquitin like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
Network
nt06122  IFN signaling (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
  Element
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    9636 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    9636 (ISG15)
   05165 Human papillomavirus infection
    9636 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    9636 (ISG15)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   9636 (ISG15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 9636
NCBI-ProteinID: NP_005092
OMIM: 147571
HGNC: 4053
Ensembl: ENSG00000187608
Vega: OTTHUMG00000040777
Pharos: P05161(Tbio)
UniProt: P05161
LinkDB All DBs
Structure
PDB: 

Position
1p36.33
AA seq 165 aa AA seqDB search
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPL
ASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDD
LFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggacctgacggtgaagatgctggcgggcaacgaattccaggtgtccctgagc
agctccatgtcggtgtcagagctgaaggcgcagatcacccagaagatcggcgtgcacgcc
ttccagcagcgtctggctgtccacccgagcggtgtggcgctgcaggacagggtccccctt
gccagccagggcctgggccccggcagcacggtcctgctggtggtggacaaatgcgacgaa
cctctgagcatcctggtgaggaataacaagggccgcagcagcacctacgaggtacggctg
acgcagaccgtggcccacctgaagcagcaagtgagcgggctggagggtgtgcaggacgac
ctgttctggctgaccttcgaggggaagcccctggaggaccagctcccgctgggggagtac
ggcctcaagcccctgagcaccgtgttcatgaatctgcgcctgcggggaggcggcacagag
cctggcgggcggagctaa

DBGET integrated database retrieval system