KEGG   Sus scrofa (pig): 100156321
Entry
100156321         CDS       T01009                                 

Gene name
SHC1
Definition
(RefSeq) SHC-transforming protein 1 isoform X2
  KO
K06279  SHC-transforming protein 1
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04510  Focal adhesion
ssc04650  Natural killer cell mediated cytotoxicity
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05034  Alcoholism
ssc05100  Bacterial invasion of epithelial cells
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05220  Chronic myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100156321 (SHC1)
   04014 Ras signaling pathway
    100156321 (SHC1)
   04072 Phospholipase D signaling pathway
    100156321 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100156321 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100156321 (SHC1)
   04062 Chemokine signaling pathway
    100156321 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100156321 (SHC1)
   04915 Estrogen signaling pathway
    100156321 (SHC1)
   04917 Prolactin signaling pathway
    100156321 (SHC1)
   04926 Relaxin signaling pathway
    100156321 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    100156321 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100156321 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100156321 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100156321 (SHC1)
   05226 Gastric cancer
    100156321 (SHC1)
   05214 Glioma
    100156321 (SHC1)
   05220 Chronic myeloid leukemia
    100156321 (SHC1)
   05224 Breast cancer
    100156321 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    100156321 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100156321 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100156321 (SHC1)
   01522 Endocrine resistance
    100156321 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100156321
NCBI-ProteinID: XP_001929432
Ensembl: ENSSSCG00000006539
Vega: OTTSUSG00000002796
UniProt: A0A5K1V5Y3
LinkDB
Position
4
AA seq 583 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPMLPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGTVGAAVPDSGPLPFLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCGRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGVPPGAARPTPPSAQTPSHLGATLPVGQPPGGDPEARKQMLPPPPCPGRE
LFDDPSYVNVQNLDKARQAGAGAGPPNPTINGSAPRDLFDMKPFEDALRVPPPPQSVAMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaacccacttcggaatgagtctctgtcatcg
ctggaggagggggcttcagggtccactccaccagaggagctgccttccccgtcagcctcg
tccctggggcccatgctgccacctctgccaggggacgacagccccaccaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaacccagctggggggcgcccagggccg
aagggggagccaggaagggcagccgaggatggggaggggaccgtcggggcagctgtaccc
gactcgggccccctacccttcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttc
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcgatgcgcgccctggac
ttcaacacccggactcaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccg
ggtgcgaagggggcgacaaggaggagaaagccctgtggccgcccactcagctccatcctg
gggaggagtaacctgaaatttgctggaatgccaatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagactgcaaacagatcatcgccaaccaccatatgcaatccatc
tcgtttgcgtccggcggggacccggacacagccgaatatgtcgcctatgttgccaaagac
ccggtgaatcagagagcctgccacatcctggagtgtcccgaagggcttgctcaggacgtc
atcagcaccattggccaggcctttgagttgcgcttcaaacaatacctcaggaacccgccc
aagctggtcacccctcatgacaggatggctggcttcgatggctcagcttgggatgaggag
gaggaagagccgcctgaccatcagtactataatgactttccggggaaggagccccctctt
gggggggtagtggacatgaggcttcgggaaggagtgcccccaggggctgctcgacccact
ccccccagcgcccagacccccagccacctgggagccacactgcctgtggggcagcctcct
gggggcgacccagaagcccgcaaacagatgctgccgcctccaccctgcccaggcagagag
ctctttgatgatccctcttatgtcaacgtccagaacctagacaaggcccggcaagcaggg
gccggggccgggccccccaatcctactatcaatggcagtgcaccccgagacctctttgac
atgaagcccttcgaagatgcccttcgggtgcctccacctccccagtcggtggccatggcc
gagcagctccgaggggagccctggttccacgggaagctgagccggcgcgaggccgaggca
ctgctgcagctcaacggggacttcctggtgcgggaaagcacgaccacacctggccagtac
gtgctgaccggcttgcagagtgggcagcccaagcacctgctcctggtggaccctgagggt
gtggttcggacaaaggatcaccgctttgagagtgtcagtcacctcatcagctaccacatg
gacaatcacttgcccatcatctctgcgggcagcgaactgtgtctccagcaacctgtggag
aggaaactgtga

KEGG   Sus scrofa (pig): 100526147
Entry
100526147         CDS       T01009                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4 isoform X1
  KO
K17449  SHC-transforming protein 4
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04510  Focal adhesion
ssc04650  Natural killer cell mediated cytotoxicity
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05034  Alcoholism
ssc05100  Bacterial invasion of epithelial cells
ssc05206  MicroRNAs in cancer
ssc05214  Glioma
ssc05220  Chronic myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100526147 (SHC4)
   04014 Ras signaling pathway
    100526147 (SHC4)
   04072 Phospholipase D signaling pathway
    100526147 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100526147 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100526147 (SHC4)
   04062 Chemokine signaling pathway
    100526147 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100526147 (SHC4)
   04915 Estrogen signaling pathway
    100526147 (SHC4)
   04917 Prolactin signaling pathway
    100526147 (SHC4)
   04926 Relaxin signaling pathway
    100526147 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    100526147 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100526147 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100526147 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100526147 (SHC4)
   05226 Gastric cancer
    100526147 (SHC4)
   05214 Glioma
    100526147 (SHC4)
   05220 Chronic myeloid leukemia
    100526147 (SHC4)
   05224 Breast cancer
    100526147 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    100526147 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100526147 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100526147 (SHC4)
   01522 Endocrine resistance
    100526147 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100526147
NCBI-ProteinID: XP_003121568
Ensembl: ENSSSCG00000004655
UniProt: A0A287B6B8
LinkDB
Position
1
AA seq 629 aa
MRERGQDSLAGLVLYVGFFGHPGMLHRAKYSRFRNESITSLDEGSPGGSAGNKGSPQPPY
PTLAPHLPTEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDLAPSSPGSPETSLNRAGPAAPPPQRDSVGHRATSLTPDACPLPHPGAPTPRNRQDR
NFLQHLLGTGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKR
KPPAKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPD
TTDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSMNTSCESEE
VHIDGHAEEKEAHEYYNEIPGKQPPAGGVSDVRVRVQATEKMAYCPIRCEKLCYLPGNSK
CSSVYENCLEQGRTIGNAQERGAQSQRDASAMKHMFRVDLFDDPCYINTQALQSTLAGNQ
SSAHPLGSPWHQEKPPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLLV
KDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNS
LPIISSGSEVSLKQPVRKDNNPGLLHSNK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggtcaggacagcctggcaggactcgtgctgtacgtaggattctttggg
caccccgggatgctgcacagggccaagtacagccgttttcggaatgagtccatcacgtcc
ttggacgaaggcagccccggaggttcggccgggaacaagggctcgccgcagcctccttac
cccaccctggcacctcacctgccgactgaagatgccaccttggcgtctcaggagagcccc
accccactgtgcaccttgatccctcgcatggccagcgtaaagctggccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtacctcggctgaagctccag
gaaagccaggacttggcccccagcagcccaggttcccctgaaaccagtctaaacagggcc
gggccagcagcacctccgcctcagcgggactcggtgggacacagggccacctctttaact
cctgatgcctgtccccttccccaccctggggcaccaacccccaggaacaggcaggacagg
aactttctgcagcacctgttggggactggcatgaactactatgtgaggtacatgggctgt
attgaagtgctgcaatcaatgaggtcactggattttggaatgagaacccaagttacaagg
gaagcaataagtcgcctgtgtgaagctgttcctggggcaaatggagccattaaaaagcga
aagcctccagctaagttcctatcaacagttctgggcaaaagtaatcttcagttttcggga
atgaatataaaactgaccatctccacatgcagcctcacattgatgaatcttgacaaccaa
cagattattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatccagat
actacagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacata
ttggaatgccgcagcggaatggcccaagacgtcataagcaccatagggcaggcttttgaa
ctccggtttaaacagtatttgaaaaatccctctatgaatacttcttgcgaaagtgaggag
gtgcatattgatggccatgctgaggagaaagaagctcatgagtattacaatgaaatccca
gggaagcagccacctgcagggggtgtgtccgatgtgcgggtcagagttcaagccacagaa
aaaatggcttactgccccatacggtgtgaaaagttgtgctatttgcctggaaactccaag
tgcagcagtgtatatgagaattgtctagaacaaggcaggacaataggcaatgcacaggag
agaggggcacagtcccagcgagatgcatctgcaatgaagcacatgttccgagtagatctc
tttgatgacccctgctacatcaacacgcaggctcttcaaagcacgcttgctggaaatcaa
agctctgctcacccgctggggagcccttggcaccaggaaaagccaccagaaactgttcag
ccaggtgccacagcccagcctgccagctcacattctttgccacacattaagcagcagcta
cggaatgaagactgctaccacggcaagctgagcaggaaagctgcagagagcctcttggta
aaggatggggactttttggtacgagagagtgcaacctctcctggccagtatgtgctgagt
gggctgcagggaggccaggccaaacatcttctcctggtggatcctgaaggcaaggtgagg
accaaggaccatgtatttgataatgttggccatctgatcagatatcacatggataatagt
ttaccaatcatctcttctggaagcgaagtaagccttaaacaaccagtgagaaaagataat
aatccaggacttttgcattccaacaaatga

KEGG   Sus scrofa (pig): 102164918
Entry
102164918         CDS       T01009                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3 isoform X1
  KO
K17448  SHC-transforming protein 3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04510  Focal adhesion
ssc04650  Natural killer cell mediated cytotoxicity
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05034  Alcoholism
ssc05100  Bacterial invasion of epithelial cells
ssc05214  Glioma
ssc05220  Chronic myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102164918 (SHC3)
   04014 Ras signaling pathway
    102164918 (SHC3)
   04072 Phospholipase D signaling pathway
    102164918 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102164918 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102164918 (SHC3)
   04062 Chemokine signaling pathway
    102164918 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102164918 (SHC3)
   04915 Estrogen signaling pathway
    102164918 (SHC3)
   04917 Prolactin signaling pathway
    102164918 (SHC3)
   04926 Relaxin signaling pathway
    102164918 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    102164918 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102164918 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102164918 (SHC3)
   05226 Gastric cancer
    102164918 (SHC3)
   05214 Glioma
    102164918 (SHC3)
   05220 Chronic myeloid leukemia
    102164918 (SHC3)
   05224 Breast cancer
    102164918 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    102164918 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102164918 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102164918 (SHC3)
   01522 Endocrine resistance
    102164918 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 102164918
NCBI-ProteinID: XP_020930093
LinkDB
Position
14
AA seq 656 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRRAPDDGP
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAAPDGSAPPGPRAPAMR
AARKGRPGDEPPPRAPHANDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKVLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSVPSKTPPPGGFVDARLKARSHG
PDTAQFAGKEQTYYQGRHLGDPFGEDWQQTPVRQGERQGSLDVYSVPEGKSHVTPVGEAP
TYVNTQRIPLQPGPAAGSSAESSPRKDLFDMKPFEDALKNQSLGPVLSKAASVECISPVS
PRAPDAKMLEELKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNPGSFVLTGMHNGQAK
HLLLVDPEGTEDESNGHTSLSVTPGITVPGTDVEPELWPLGLGRTWTTPYKRPDPDKGQD
LRQYQPPHPPPPGEQPAHRLCWQRALPPAASGEEPVTCQLPCPDVPLWSGRLSSSC
NT seq 1971 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtggatgac
cttctgcacaacctgtcggtgagcggcgggggcaaggtctcggcggcgcgcgcagccccg
gcggcggccccctacctggtgtccggagacgcgctgcgcagggcgcccgacgatgggcca
ggcagcttgggccacctgctccacaaggtgtcccacctgaaactctccagttcgggcctc
cgcggcctgtcggcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgct
cccagcctggccgccccggacggcagcgcgccccccggcccccgcgccccggccatgcgc
gccgccagaaagggccgacccggcgacgagccgccgccccgcgccccgcacgccaacgac
caggtgctgggggctggagtcacctacgtcgtcaagtacttggggtgcattgaagttcta
cgctccatgaggtcacttgacttcagtacaagaacacagattaccagggaagccatcagc
cgggtttgcgaagccgtccctggcgccaagggagccttcaggaagagaaagcctcccagc
aaagtgctgtccagcatcctgggcaagagcaacctccagtttgcggggatgagcatctcc
ctgaccatttccaccgccagcctgaacctgcggacgccggactcgaaacagattatagcg
aatcatcacatgcagtccatttctttcgcctccgggggagacccggacaccacagactac
gttgcatatgtagctaaggaccccgttaatcgcagagcttgtcacattctggagtgttgt
gacgggctggcccaggacgtcattggctccattggacaagccttcgagctccggtttaag
cagtatctgcagtgtccttccaagatccccgctctccatgaccgaatgcagagtctagat
gagccatggactgaagaggagggcgatggctcagaccacccgtactacaacagcgttcca
agcaagacacctcctccagggggatttgttgatgctcgactgaaagccagatcccatggc
cctgacacagcgcagtttgcaggaaaagagcaaacttactaccaggggagacacttggga
gacccgtttggcgaagactggcagcagacacctgtcaggcaaggcgagaggcaagggtcc
ttggatgtctatagcgtgcccgaagggaaatcgcatgtgaccccagtaggagaagccccc
acctatgtcaacacccagcgcatcccgctgcagcccgggccggctgcaggcagcagtgca
gagagcagcccaaggaaagacctctttgacatgaaaccttttgaagatgctctcaagaac
cagtctttggggcctgtgttgagcaaggcagcctctgtggaatgcatcagccccgtctcc
cccagagcccccgatgcaaagatgctggaagagctaaaagcagagccttggtaccaaggg
gagatgagcaggaaggaggcggaggggctgctgaagagagatggagatttcctggtcagg
aagagcaccaccaacccgggctccttcgttctcaccggcatgcacaacggccaggccaag
catctgctgctcgtggacccagaaggcacggaagatgaaagcaatggacatacaagtcta
agtgtgactcctggaattacagtcccagggactgatgtggaaccagaactatggccattg
ggtttaggaaggacctggaccacaccttataaaaggccagatccggacaaaggacaggat
cttcgacagtatcagccacctcatccaccaccacctggagaacagcctgcccatcgtctc
tgctggcagcgagctctgcctccagcagccagtggagaggaacccgtgacctgccagctg
ccctgtcctgatgtgcctctgtggtcaggaagactcagctcttcctgctag

KEGG   Sus scrofa (pig): 110259382
Entry
110259382         CDS       T01009                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04062  Chemokine signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04370  VEGF signaling pathway
ssc04510  Focal adhesion
ssc04650  Natural killer cell mediated cytotoxicity
ssc04722  Neurotrophin signaling pathway
ssc04910  Insulin signaling pathway
ssc04915  Estrogen signaling pathway
ssc04917  Prolactin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04935  Growth hormone synthesis, secretion and action
ssc05034  Alcoholism
ssc05100  Bacterial invasion of epithelial cells
ssc05214  Glioma
ssc05220  Chronic myeloid leukemia
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110259382 (SHC2)
   04014 Ras signaling pathway
    110259382 (SHC2)
   04370 VEGF signaling pathway
    110259382 (SHC2)
   04072 Phospholipase D signaling pathway
    110259382 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110259382 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110259382 (SHC2)
   04062 Chemokine signaling pathway
    110259382 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110259382 (SHC2)
   04915 Estrogen signaling pathway
    110259382 (SHC2)
   04917 Prolactin signaling pathway
    110259382 (SHC2)
   04926 Relaxin signaling pathway
    110259382 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    110259382 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110259382 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110259382 (SHC2)
   05226 Gastric cancer
    110259382 (SHC2)
   05214 Glioma
    110259382 (SHC2)
   05220 Chronic myeloid leukemia
    110259382 (SHC2)
   05224 Breast cancer
    110259382 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    110259382 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    110259382 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110259382 (SHC2)
   01522 Endocrine resistance
    110259382 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 110259382
NCBI-ProteinID: XP_020939968
LinkDB
Position
2
AA seq 585 aa
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRGPAAARAAGSAGST
DPEPEPEPADSAGVPALAAAVLGACEPRCAAPCPLPALSRCRAAGTRGPRGARGVAGPPD
AAADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFSTRTQVT
REAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISIDGLNLSVPATR
QIIANHHMQSISFASGGDTDMADYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAFE
LRFKQYLHSPPKVVVPPERLTGLEDSAWGDEEETEHNYYNSVPGKEPPLGGLLDSRLALT
QPCALGALSQGASPARRDTRGLQWDMGPSVPAPPGDGYVQADARGPRDYEDHLYVNTQGL
DGPEGLQAEDSPKKDLFDMRPFEDALRLHECSMAAGTAAAPLPVEDQWPSPPTRRAPIAP
TEEQLRQEPWYHGQMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDP
EGVVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcgcgccccccgcgccccctgcaccccccgagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgccgcccct
gccgggttcctgggccgcggccccgcagcggcgcgtgcagcggggagcgcggggtccact
gaccccgagcctgagcccgagccggccgactcggccggcgtcccggcgctggcagccgcg
gtcctgggtgcttgcgagccgcgctgcgcggcgccctgccccctgcctgctctcagccgc
tgccgggccgccggtactcgggggccacggggcgcgcggggagtggccgggcccccggac
gccgccgcggacgagtggatccgcaagggcagcttcatccacaagccggcgcacggctgg
ctacacccagacgccagggtcttggggcccggggtctcctacatcgttcggtacatgggc
tgcatcgaagtccttcgctccatgcgctccctggacttcagcactcgcacccaggtcacc
agggaagccatcaaccggctccatgaggccgtgcctggagtccggggctcctggaagaag
aaggcccccaacaaagcgctggcctccatcctgggcaagagcaatctgcgcttcgcggga
atgagcattgcggtcagcatctccattgatggcctcaacctctcggtgccggccacacgc
cagatcatcgccaaccaccacatgcagtccatctccttcgcgtcaggtggtgacacggac
atggcggactacgtggcctatgtggccaaggaccccatcaaccagagagcctgccacatt
ctggagtgctgcgagggcctcgcccagagcgtcatcagcaccgtgggccaagccttcgag
ctgcgcttcaaacagtacctgcacagcccccccaaggtggtcgtccccccggaaaggctg
acggggctggaggactcagcctggggggacgaggaggagaccgaacacaactactacaac
agcgtccctgggaaggagccacccctgggcgggctgctggactccaggctggccctcaca
cagccctgtgcccttggggccctcagccagggagcatctcctgctcgaagagacacccgt
ggcctacagtgggatatggggccctcagtcccagccccgccgggggacggctacgtgcag
gcggatgcccgtggcccccgagactacgaggaccacctgtatgtcaacactcagggtctg
gatggccccgagggcctgcaggccgaggacagccccaagaaggacctgttcgatatgcga
cccttcgaggatgccctgaggctgcacgaatgctccatggctgcaggtaccgcagcagcg
ccccttccggtggaagaccagtggcccagcccccctacgcgccgggcccccattgccccc
accgaggagcagcttcggcaggagccttggtaccacggccaaatgagccggcgggcggcg
gagaaattgcttcgagccgatggggatttcctcgtccgcgacagcgtcactaaccccgga
cagtatgtcctcaccggcatgcacgctgggcagcccaagcacctgctgcttgtggaccct
gagggcgtggtgcggacaaaggacgtgctgtttgagagtatcagtcacctgatcgactat
cacctgcagaatgggcagcccattgtggccgcggagagtgagctgcacctgcggggtgtg
gtcaagcgggagccctga

DBGET integrated database retrieval system