KEGG   COMPOUND: C00046
Entry
C00046                      Compound                               
Name
RNA;
RNAn;
RNAn+1;
RNA(linear);
(Ribonucleotide)n;
(Ribonucleotide)m;
(Ribonucleotide)n+m;
Ribonucleic acid
Formula
C10H18O13P2R2(C5H8O6PR)n
Structure
Comment
Generic compound in reaction hierarchy
Reaction
Pathway
map00230  Purine metabolism
map00240  Pyrimidine metabolism
map01100  Metabolic pathways
map05014  Amyotrophic lateral sclerosis
map05171  Coronavirus disease - COVID-19
Enzyme
2.7.7.6         2.7.7.8         2.7.7.19        2.7.7.48        
2.7.7.52        6.5.1.3
Other DBs
PubChem: 3348
LinkDB
KCF data

ATOM        40
            1   C1y C    30.1700  -21.3500
            2   C1y C    30.5900  -22.6100
            3   C1y C    31.9900  -22.6100
            4   C1y C    32.4100  -21.2800
            5   O2x O    31.2900  -20.4400
            6   O1a O    29.8200  -23.8000
            7   C1y C    26.0400  -16.5200
            8   C1y C    26.4600  -17.7800
            9   C1y C    27.8600  -17.7800
            10  C1y C    28.2800  -16.4500
            11  O2x O    27.1600  -15.6100
            12  R   R    29.6100  -15.9600
            13  O2b O    25.6900  -18.9700
            14  P1b P    25.6900  -20.3700
            15  O1c O    24.2900  -20.3700
            16  O1c O    25.6900  -21.7700
            17  C1y C    21.6300  -11.6200
            18  C1y C    22.0500  -12.8800
            19  C1y C    23.4500  -12.8800
            20  C1y C    23.8700  -11.5500
            21  O2x O    22.7500  -10.7100
            22  R   R    25.2000  -11.0600
            23  C1b C    20.3000  -11.2000
            24  O2b O    19.3200  -12.1800
            25  O2b O    21.2800  -14.0700
            26  P1b P    21.2800  -15.4700
            27  O1c O    19.8800  -15.4700
            28  O1c O    21.2800  -16.8700
            29  O2b O    22.6800  -15.4700
            30  C1b C    24.9200  -15.4700
            31  O2b O    27.0900  -20.3700
            32  C1b C    28.7700  -20.3700
            33  P1b P    17.9200  -12.1800
            34  O1c O    16.5200  -12.1800
            35  O1c O    17.9200  -10.7800
            36  O1c O    17.9200  -13.5800
            37  R   R    33.7430  -20.8520
            38  O1a O    24.2776  -14.0092
            39  O1a O    28.6876  -18.9092
            40  O1a O    32.8176  -23.7392
BOND        42
            1     1   2 1
            2     2   3 1
            3     3   4 1
            4     4   5 1
            5     1   5 1
            6     2   6 1 #Down
            7     7   8 1
            8     8   9 1
            9     9  10 1
            10   10  11 1
            11    7  11 1
            12   10  12 1 #Up
            13    8  13 1 #Down
            14   13  14 1
            15   14  15 1
            16   14  16 2
            17   17  18 1
            18   18  19 1
            19   19  20 1
            20   20  21 1
            21   17  21 1
            22   20  22 1 #Up
            23   17  23 1 #Up
            24   23  24 1
            25   18  25 1 #Down
            26   25  26 1
            27   26  27 1
            28   26  28 2
            29   26  29 1
            30   29  30 1
            31    7  30 1 #Up
            32   14  31 1
            33   31  32 1
            34    1  32 1 #Up
            35   24  33 1
            36   33  34 1
            37   33  35 1
            38   33  36 2
            39    4  37 1 #Up
            40   19  38 1 #Down
            41    9  39 1 #Down
            42    3  40 1 #Down
BRACKET     1    24.2900  -16.3100   24.2900  -14.7000
            1    27.5100  -19.6000   27.5100  -21.2100
            1  n
 ORIGINAL  1    7   8   9  10  11  12  13  14  15  16  30  31  39
 REPEAT    1

» Japanese version

KEGG   Homo sapiens (human): 4686
Entry
4686              CDS       T01001                                 
Symbol
NCBP1, CBP80, NCBP, Sto1
Name
(RefSeq) nuclear cap binding protein subunit 1
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Drug target
Obefazimod: D12345
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4686 (NCBP1)
  09122 Translation
   03013 Nucleocytoplasmic transport
    4686 (NCBP1)
   03015 mRNA surveillance pathway
    4686 (NCBP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4686 (NCBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4686 (NCBP1)
   03041 Spliceosome [BR:hsa03041]
    4686 (NCBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     4686 (NCBP1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    4686 (NCBP1)
SSDB
Motif
Pfam: MIF4G_like_2 MIF4G_like MIF4G Jnk-SapK_ap_N Tropomyosin_1
Other DBs
NCBI-GeneID: 4686
NCBI-ProteinID: NP_002477
OMIM: 600469
HGNC: 7658
Ensembl: ENSG00000136937
Vega: OTTHUMG00000020332
Pharos: Q09161(Tbio)
UniProt: Q09161 A0A024R179
Structure
LinkDB
Position
9:97633821..97673748
AA seq 790 aa
MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEAD
LPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN
YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWV
GKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK
KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEG
PVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF
QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPAN
PTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFN
PLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQM
IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELE
EAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI
LTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILA
VFQQFCALQA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgtcgcggcggcggcacagcgacgagaacgacggtgggcagcctcacaaaaggagaaag
acctctgatgcaaatgaaactgaagatcatttggaatctttaatatgtaaagtaggagaa
aagagtgcctgctctttggagagcaacctagaaggcttggctggtgttttggaagctgat
cttcctaactacaagagcaagatcttaaggcttctttgtacagttgcacgcctattacct
gagaagctgacaatttatacaacattagttggactactgaatgccaggaattacaatttt
ggtggagaatttgtagaagccatgattcgtcaacttaaagaatcattgaaagcaaacaat
tataatgaagccgtgtatttggtccgttttttatctgatcttgtgaattgtcatgtgatt
gccgccccatcaatggttgctatgtttgaaaattttgtaagcgtaactcaggaagaagat
gtacctcaggtgcgacgagattggtatgtgtatgcatttctgtcatctttgccctgggtt
ggaaaggagttgtacgaaaagaaagatgcagagatggaccgcatctttgccaacactgaa
agctatcttaaaagacgccaaaagactcatgtacccatgttacaggtatggactgctgat
aaaccacatccacaagaagagtatttagattgcctgtgggcccagattcagaaattgaaa
aaggatcgctggcaggaacggcacatcctaagaccttatcttgcctttgacagcatcctg
tgtgaagcactgcagcacaatctgcctccttttacaccacctcctcacactgaagattca
gtgtacccaatgccaagggtcatcttcagaatgtttgattacacagatgatcccgagggt
cctgtcatgccagggagtcattcagtggaaagatttgtaatagaagagaatcttcactgc
atcattaagtcccactggaaggaaaggaagacttgtgctgcacagttagtgagctatcca
gggaagaacaagatccccttgaactaccacatagttgaggtgatctttgcagagctgttt
caacttccagcaccccctcacattgatgtgatgtacacaacactcctcattgaactgtgc
aaacttcaacctggctctctaccccaagttcttgcacaggcaactgaaatgctatacatg
cgtttggacacaatgaacactacctgtgtagacaggtttattaattggttttctcatcat
ctaagtaacttccagttccgttggagctgggaagattggtcagattgtcttagtcaagat
cctgaaagtcccaaaccgaagtttgtaagagaagttctagaaaaatgtatgaggttgtct
taccatcagcgtatattagatattgttcctcctaccttctcagctctgtgtcctgcaaac
ccaacctgcatttacaagtatggagatgaaagtagcaattctcttcctggacattctgtt
gccctctgtttagctgttgcctttaaaagtaaggcaaccaatgatgaaatcttcagcatt
ctgaaagatgtaccaaatcctaaccaggatgatgacgacgatgaaggattcagttttaac
ccattgaaaatagaagtctttgtacagactctgctacacttggcagccaaatcattcagc
cactccttcagtgctcttgcaaagtttcatgaagtcttcaaaaccctagctgaaagtgat
gaaggaaagttacatgtgctaagagttatgtttgaggtctggaggaaccatccacagatg
attgctgtactagtggataagatgattcgtacacaaatagttgattgtgctgccgtagca
aattggatcttctcttcagaactatctcgtgactttaccagattgtttgtttgggaaatt
ttgcactctacaattcgtaagatgaacaaacatgtcctgaagatccagaaagagctggaa
gaagctaaagagaaacttgctaggcaacacaaacggcgaagtgatgatgacgacagaagc
agtgacaggaaagacggggttcttgaggaacaaatagaacgacttcaggaaaaagtggaa
tctgctcagagtgaacaaaagaatcttttcctcgttatatttcagcggtttatcatgatc
ttgaccgagcacctagtacgatgcgaaactgatgggaccagtgtattaacaccatggtat
aagaactgtatagagaggctgcagcagatcttcctacagcatcaccaaataatccagcag
tacatggtgaccctggagaaccttctcttcactgctgaattagaccctcatatcttggcc
gtgttccagcagttctgtgccctgcaggcctaa

KEGG   Homo sapiens (human): 10189
Entry
10189             CDS       T01001                                 
Symbol
ALYREF, ALY, ALY/REF, BEF, REF, THOC4
Name
(RefSeq) Aly/REF export factor
  KO
K12881  THO complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10189 (ALYREF)
  09122 Translation
   03013 Nucleocytoplasmic transport
    10189 (ALYREF)
   03015 mRNA surveillance pathway
    10189 (ALYREF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10189 (ALYREF)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10189 (ALYREF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10189 (ALYREF)
   03041 Spliceosome [BR:hsa03041]
    10189 (ALYREF)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10189 (ALYREF)
    TREX complex
     10189 (ALYREF)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    10189 (ALYREF)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    10189 (ALYREF)
SSDB
Motif
Pfam: RRM_1 FoP_duplication FYTT RRM_5
Other DBs
NCBI-GeneID: 10189
NCBI-ProteinID: NP_005773
OMIM: 604171
HGNC: 19071
Ensembl: ENSG00000183684
Vega: OTTHUMG00000160470
Pharos: Q86V81(Tbio)
UniProt: Q86V81 E9PB61
Structure
LinkDB
Position
17:complement(81887835..81891587)
AA seq 264 aa
MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGG
PIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNL
DFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDG
RPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRN
SKQQLSAEELDAQLDAYNARMDTS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcccgattccgcgcccgccatggccgacaaaatggacatgtctctggacgacatcatt
aaactgaaccggagccagcgaggcggccggggcgggggccggggccgcggccgggccggc
tcccagggcggccgcggcggtggggcgcaggccgccgcgcgagtgaatcgaggcggcggg
cccatccggaaccggccggccatcgcccgcggcgcggccggcggaggcggcaggaaccga
ccggcgccctacagcaggccaaaacaacttcccgacaagtggcagcacgatcttttcgac
agtggcttcggcggtggtgccggcgtggagacaggtgggaaactgctggtgtccaatctg
gattttggagtctcagacgccgatattcaggaactctttgctgaatttggaacgctgaag
aaggcggctgtgcactatgatcgctctggtcgcagcttaggaacagcagacgtgcacttt
gagcggaaggcagatgccctgaaggccatgaagcagtacaacggcgtccctctggatggc
cgccccatgaacattcagcttgtcacgtcacagattgacgcacagcggaggcctgcacag
agcgtaaacagaggtggcatgactagaaaccgtggcgctggaggttttggtggtggtgga
ggcacccggagaggcacccgcggaggcgcccgtggaagaggcagaggtgccggcaggaat
tcaaagcagcagctttcggcagaggagctggatgcccagctggacgcctataatgcgaga
atggacaccagttaa

KEGG   Homo sapiens (human): 6428
Entry
6428              CDS       T01001                                 
Symbol
SRSF3, SFRS3, SRp20
Name
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  serine/arginine-rich splicing factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6428 (SRSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6428 (SRSF3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6428 (SRSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 6428
NCBI-ProteinID: NP_003008
OMIM: 603364
HGNC: 10785
Ensembl: ENSG00000112081
Vega: OTTHUMG00000014599
Pharos: P84103(Tbio)
UniProt: P84103 B2R6F3
Structure
LinkDB
Position
6:36594362..36605600
AA seq 164 aa
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

KEGG   Homo sapiens (human): 6432
Entry
6432              CDS       T01001                                 
Symbol
SRSF7, 9G8, AAG3, SFRS7
Name
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6432 (SRSF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6432 (SRSF7)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6432 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Other DBs
NCBI-GeneID: 6432
NCBI-ProteinID: NP_001026854
OMIM: 600572
HGNC: 10789
Ensembl: ENSG00000115875
Vega: OTTHUMG00000102076
Pharos: Q16629(Tbio)
UniProt: Q16629
Structure
LinkDB
Position
2:complement(38743599..38751494)
AA seq 238 aa
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

KEGG   Homo sapiens (human): 10482
Entry
10482             CDS       T01001                                 
Symbol
NXF1, MEX67, TAP
Name
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    10482 (NXF1)
   03015 mRNA surveillance pathway
    10482 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    10482 (NXF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    10482 (NXF1)
   05168 Herpes simplex virus 1 infection
    10482 (NXF1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10482 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10482 (NXF1)
   03009 Ribosome biogenesis [BR:hsa03009]
    10482 (NXF1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     10482 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     10482 (NXF1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    10482 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 10482
NCBI-ProteinID: NP_006353
OMIM: 602647
HGNC: 8071
Ensembl: ENSG00000162231
Vega: OTTHUMG00000167612
Pharos: Q9UBU9(Tbio)
UniProt: Q9UBU9
Structure
LinkDB
Position
11:complement(62792130..62805440)
AA seq 619 aa
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggcggacgaggggaagtcgtacagcgaacacgatgatgaacgcgttaatttccctcaa
agaaagaagaaaggccggggtcccttccggtggaaatatggtgaaggaaaccgtaggtct
ggaagaggcggttctggtattcggtcttcccgccttgaggaagatgatggagatgtggca
atgagtgatgcccaggatggtccccgagtacgatacaacccctataccacccgacctaac
cgtcggggtgatacttggcatgatcgagatcgcattcatgttactgtgcggagagacaga
gctcctccagagagaggaggggctggcaccagccaggatgggacctcaaagaactggttc
aagattacaattccttatggcagaaagtatgacaaggcatggctcctgagcatgattcag
agcaagtgcagtgtgcccttcacccctattgagtttcactatgagaatacacgggcccag
ttcttcgttgaagacgccagtactgcctctgcattgaaggctgtcaactataagattttg
gatcgggagaaccgaaggatatctatcatcatcaactcttctgctccaccccacactata
ctgaatgaactgaagccagaacaagtagaacagctaaagctgatcatgagcaaacgatac
gatggctcccaacaagcccttgacctcaaaggcctccgttcagacccagatttggtggcc
cagaacattgacgttgtcctgaatcgcagaagctgtatggcagctaccctgaggatcatt
gaagagaacatccctgagctattgtccttgaacttgagcaacaacaggctgtacaggctg
gatgacatgtctagcattgttcagaaggcacccaacctgaagatcctaaacctttctgga
aatgaattgaagtctgagcgggaattggacaagataaaggggctgaagctagaagagctc
tggctcgatggaaactccctgtgtgacaccttccgagaccagtccacctacatcagcgcc
attcgcgaacgatttcccaagttactacgcctggatggccatgagctacccccaccaatt
gcctttgatgttgaagcccccacgacgttaccgccctgcaagggaagctattttggaaca
gaaaacttgaagagtctggtcttgcacttcctgcaacagtactatgcaatttacgactct
ggagaccgacaagggctcctggatgcctaccatgatggggcctgctgttccctgagcatt
cctttcattcctcagaaccctgcccgaagcagcttagccgagtatttcaaggatagcaga
aatgtgaagaagcttaaagaccctaccttgcggttccggctgctgaagcacacgcgtctc
aacgttgttgccttcctcaatgagttgcccaaaacccagcacgacgtcaattccttcgtg
gtagacataagcgcccagacaagcacattgctgtgtttttctgtcaatggagtcttcaag
gaagtggacggaaagtcccgggattctttgcgagccttcacccggacattcattgctgtt
cctgctagcaattcagggctatgtattgtaaatgatgagctatttgtgcggaatgccagt
tctgaagagatccaaagagccttcgctatgcctgcacccacgccttcctccagcccggtg
cccaccctctctccagagcagcaggaaatgttgcaagcattctctacccagtctggcatg
aacctcgagtggtcccagaagtgccttcaggacaacaactgggactacaccagatctgcc
caggccttcactcatctcaaggccaagggcgagatcccagaagtggcattcatgaagtga

KEGG   Homo sapiens (human): 29107
Entry
29107             CDS       T01001                                 
Symbol
NXT1, MTR2, P15
Name
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06170  Influenza A virus (IAV)
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N00746  IAV NS1 to nuclear export of mRNA
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    29107 (NXT1)
   03015 mRNA surveillance pathway
    29107 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    29107 (NXT1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    29107 (NXT1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29107 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29107 (NXT1)
   03009 Ribosome biogenesis [BR:hsa03009]
    29107 (NXT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     29107 (NXT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    29107 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF
Other DBs
NCBI-GeneID: 29107
NCBI-ProteinID: NP_037380
OMIM: 605811
HGNC: 15913
Ensembl: ENSG00000132661
Vega: OTTHUMG00000032059
Pharos: Q9UKK6(Tbio)
UniProt: Q9UKK6
Structure
LinkDB
Position
20:23350791..23354771
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAS
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt
gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg
ggcacagccaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag
ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt
catgatgaagccacaccaagccagaccacggtccttgttgtcatctgtggatcagtgaag
tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctca
cccagcaacacagtgtggaagatcgcaagtgactgcttccgcttccaggactgggccagc
tag

KEGG   Homo sapiens (human): 55916
Entry
55916             CDS       T01001                                 
Symbol
NXT2, P15-2
Name
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05164  Influenza A
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    55916 (NXT2)
   03015 mRNA surveillance pathway
    55916 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    55916 (NXT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    55916 (NXT2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    55916 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    55916 (NXT2)
   03009 Ribosome biogenesis [BR:hsa03009]
    55916 (NXT2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     55916 (NXT2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    55916 (NXT2)
SSDB
Motif
Pfam: NTF2 SnoaL_2
Other DBs
NCBI-GeneID: 55916
NCBI-ProteinID: NP_001229546
OMIM: 300320
HGNC: 18151
Ensembl: ENSG00000101888
Vega: OTTHUMG00000022185
Pharos: Q9NPJ8(Tdark)
UniProt: Q9NPJ8
LinkDB
Position
X:109535824..109544698
AA seq 142 aa
MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALN
NFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQS
TPNNTVWKIASDCFRFQDWSSS
NT seq 429 nt   +upstreamnt  +downstreamnt
atggccacgtctctggattttaaaacttatgtagatcaggcatgtagagctgctgaggag
tttgtcaatatttactatgagacaatggataaaagaagacgggcactaaccaggctgtat
ctggacaaggccaccttaatatggaatggaaatgctgtttcagggctggatgccctaaat
aatttttttgacacattgccttctagtgagttccaggtcaatatgttagattgccaacca
gttcatgagcaagcaactcagtcccaaactacagttcttgttgtgaccagtggaactgtg
aagtttgatggaaacaaacaacatttcttcaaccagaacttcctgctgactgctcagtcc
actcccaacaatactgtgtggaagattgcaagtgattgcttccgttttcaagattggtct
agtagttaa

DBGET integrated database retrieval system