KEGG   Aureococcus anophagefferens: AURANDRAFT_22298
Entry
AURANDRAFT_22298  CDS       T04134                                 

Definition
(RefSeq) hypothetical protein
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
aaf  Aureococcus anophagefferens
Pathway
aaf00790  Folate biosynthesis
aaf01100  Metabolic pathways
aaf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:aaf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AURANDRAFT_22298
Enzymes [BR:aaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     AURANDRAFT_22298
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     AURANDRAFT_22298
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-GeneID: 20219587
NCBI-ProteinID: XP_009034429
JGI: Auran1_22298
UniProt: F0Y1M6
LinkDB
Position
Unknown
AA seq 201 aa
MDVQCVPCDYDPVFEVQVRSERFKFNASHFVAFRGFRERLHGHNYTVGVRVFGPLSPDDG
YVLDFGDVKKTVRGVCETLNERFLCPCRSDVLDIRDAGPNVELTAEDGAFFSIPLGDCAM
LPIVHSTAEELAAMIWHKTIEAFGVDILKKRGITAIEIAVAEAPMQEARYRRKLAGFAPG
AAPIPARAPNAGCGANITPAG
NT seq 606 nt   +upstreamnt  +downstreamnt
atggacgtccagtgcgtgccctgcgactacgacccggtcttcgaggtgcaggtgcgcagc
gagcgcttcaagttcaacgcgtcccacttcgtggcgttccgcggcttccgcgagcggctc
cacggccacaactacacggtgggcgtgcgcgtcttcggcccgctgtcgcccgacgacggc
tacgtgctcgacttcggggacgtgaagaagacggtgcgcggcgtctgcgagacgctcaac
gagcggttcctgtgcccgtgccggtcggacgtgctggacatccgcgacgcggggcccaac
gtcgagctcacggccgaggacggcgccttcttctccatcccgctcggcgactgcgccatg
ctgcccatcgtccactcgaccgcggaggagctcgcggcgatgatctggcacaagaccatc
gaggcgttcggcgtcgacatcctgaaaaagcggggcatcacggccatcgagatcgccgtc
gccgaggcgcccatgcaggaggcgcgctaccggcggaagctcgcgggcttcgcgcccggg
gccgcgccgatccccgcgcgcgcgccaaacgcgggctgcggcgcaaacatcacgccggcg
ggctaa

DBGET integrated database retrieval system