KEGG   Addendum: AKO60175
Entry
AKO60175          CDS       T10000                                 
Symbol
REPI
Name
(KEGG) reticuline epimerase
  KO
K22093  1,2-dehydroreticuline synthase/reductase [EC:1.14.19.54 1.5.1.27]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
ag  Addendum (Papaver somniferum)
SSDB
Motif
Pfam: p450 Aldo_ket_red
Other DBs
NCBI-ProteinID: AKO60175
GB: KP985715
UniProt: A0A0H4IM19
LinkDB
AA seq 900 aa
MELQYISYFQPTSSVVALLLALVSILSSVVVLRKTFLNNYSSSPASSTKTAVLSHQRQQS
CALPISGLLHIFMNKNGLIHVTLGNMADKYGPIFSFPTGSHRTLVVSSWEMVKECFTGNN
DTAFSNRPIPLAFKTIFYACGGIDSYGLSSVPYGKYWRELRKVCVHNLLSNQQLLKFRHL
IISQVDTSFNKLYELCKNSEDNQGNYPTTTTAAGMVRIDDWLAELSFNVIGRIVCGFQSG
PKTGAPSRVEQFKEAINEASYFMSTSPVSDNVPMLGWIDQLTGLTRNMKHCGKKLDLVVE
SIINDHRQKRRFSRTKGGDEKDDEQDDFIDICLSIMEQPQLPGNNNPSQIPIKSIVLDMI
GGGTDTTKLTTIWTLSLLLNNPHVLDKAKQEVDAHFRTKRRSTNDAAAAVVDFDDIRNLV
YIQAIIKESMRLYPASPVVERLSGEDCVVGGFHVPAGTRLWANVWKMQRDPKVWDDPLVF
RPDRFLSDEQKMVDVRGQNYELLPFGAGRRVCPGVSFSLDLMQLVLTRLILEFEMKSPSG
KVDMTATPGLMSYKVIPLDILLTHRRIKPCVQSAASERDMESSGVPVITLGSGKVMPVLG
MGTFEKVGKGSERERLAILKAIEVGYRYFDTAAAYETEEVLGEAIAEALQLGLVKSRDEL
FISSMLWCTDAHADRVLLALQNSLRNLKLEYVDLYMLPFPASLKPGKITMDIPEEDICRM
DYRSVWAAMEECQNLGFTKSIGVSNFSCKKLQELMATANIPPAVNQVEMSPAFQQKKLRE
YCNANNILVSAISVLGSNGTPWGSNAVLGSEVLKKIAMAKGKSVAQVSMRWVYEQGASLV
VKSFSEERLRENLNIFDWELTKEDHEKIGEIPQCRILSAYFLVSPNGPFKSQEELWDDEA
Comment
Unpublished sequence data: Facchini PJ, Farrow SC (2015).
Reference
  Authors
Farrow SC, Hagel JM, Beaudoin GA, Burns DC, Facchini PJ
  Title
Stereochemical inversion of (S)-reticuline by a cytochrome P450 fusion in opium poppy.
  Journal
Nat Chem Biol 11:728-32 (2015)
DOI:10.1038/nchembio.1879

DBGET integrated database retrieval system