KEGG   Homo sapiens (human): 100532731
Entry
100532731         CDS       T01001                                 
Symbol
COMMD3-BMI1, BMI1, PCGF4, RNF51
Name
(RefSeq) COMMD3-BMI1 readthrough
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100532731 (COMMD3-BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100532731 (COMMD3-BMI1)
   05206 MicroRNAs in cancer
    100532731 (COMMD3-BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    100532731 (COMMD3-BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     100532731 (COMMD3-BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_5 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-Nse zf-RING_10
Other DBs
NCBI-GeneID: 100532731
NCBI-ProteinID: NP_001190991
HGNC: 48326
Ensembl: ENSG00000269897
Vega: OTTHUMG00000184031
UniProt: P35226 R4GMX3
Structure
LinkDB
Position
10:22316388..22331484
AA seq 469 aa
MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLK
HCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGRTLI
PHPIQRLVLVAAWNNYRIFYQAEMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHS
FCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDF
YAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEE
VNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRR
NGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPST
PVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggagctctcggagtctgtgcagaaaggcttccagatgctggcggatccccgctccttc
gactccaacgccttcacgcttctcctccgggcggcattccagagtctgctggacgcccag
gcggacgaggccgtgttagatcatccagacttgaaacatatcgacccagtggttttaaaa
cattgtcatgcagcagctgcaacttacatactagaggcaggaaagcaccgagctgacaag
tcaactctaagcacttatctagaagactgtaaatttgacagagagcgaatagaactgttt
tgcacggaatatcagaataataagaattccctagaaatcctactgggaagaacactgatt
ccccatcctatccagagattagttttagttgcagcatggaacaattacaggattttttat
caagcagaaatgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatg
tgtgtgctttgtggagggtacttcattgatgccacaaccataatagaatgtctacattcc
ttctgtaaaacgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgat
gtccaagttcacaagaccagaccactactgaatataaggtcagataaaactctccaagat
attgtatacaaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttt
tatgcagctcatccttctgctgatgctgccaatggctctaatgaagatagaggagaggtt
gcagatgaagataagagaattataactgatgatgagataataagcttatccattgaattc
tttgaccagaacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggag
gtgaatgataaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaag
tttctcagaagtaaaatggacatacctaatactttccagattgatgtcatgtatgaggag
gaacctttaaaggattattatacactaatggatattgcctacatttatacctggagaagg
aatggtccacttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagt
caccagagagatggactgacaaatgctggagaactggaaagtgactctgggagtgacaag
gccaacagcccagcaggaggtattccctccacctcttcttgtttgcctagccccagtact
ccagtgcagtctcctcatccacagtttcctcacatttccagtactatgaatggaaccagc
aacagccccagcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagta
aatgggtcatcagcaacttcttctggttga

KEGG   Homo sapiens (human): 648
Entry
648               CDS       T01001                                 
Symbol
BMI1, FLVI2/BMI1, PCGF4, RNF51, flvi-2/bmi-1
Name
(RefSeq) BMI1 proto-oncogene, polycomb ring finger
  KO
K11459  polycomb group RING finger protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
Disease
H00025  Penile cancer
Drug target
Unesblin: D11889
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    648 (BMI1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    648 (BMI1)
   05206 MicroRNAs in cancer
    648 (BMI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    648 (BMI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     648 (BMI1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 648
NCBI-ProteinID: NP_005171
OMIM: 164831
HGNC: 1066
Ensembl: ENSG00000168283
Vega: OTTHUMG00000017807
Pharos: P35226(Tbio)
UniProt: P35226
Structure
LinkDB
Position
10:22321099..22331484
AA seq 326 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLR
SKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR
DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSP
SGNHQSSFANRPRKSSVNGSSATSSG
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcatcgaacaacgagaatcaagatcactgagctaaatccccacctgatgtgtgtgctt
tgtggagggtacttcattgatgccacaaccataatagaatgtctacattccttctgtaaa
acgtgtattgttcgttacctggagaccagcaagtattgtcctatttgtgatgtccaagtt
cacaagaccagaccactactgaatataaggtcagataaaactctccaagatattgtatac
aaattagttccagggcttttcaaaaatgaaatgaagagaagaagggatttttatgcagct
catccttctgctgatgctgccaatggctctaatgaagatagaggagaggttgcagatgaa
gataagagaattataactgatgatgagataataagcttatccattgaattctttgaccag
aacagattggatcggaaagtaaacaaagacaaagagaaatctaaggaggaggtgaatgat
aaaagatacttacgatgcccagcagcaatgactgtgatgcacttaagaaagtttctcaga
agtaaaatggacatacctaatactttccagattgatgtcatgtatgaggaggaaccttta
aaggattattatacactaatggatattgcctacatttatacctggagaaggaatggtcca
cttccattgaaatacagagttcgacctacttgtaaaagaatgaagatcagtcaccagaga
gatggactgacaaatgctggagaactggaaagtgactctgggagtgacaaggccaacagc
ccagcaggaggtattccctccacctcttcttgtttgcctagccccagtactccagtgcag
tctcctcatccacagtttcctcacatttccagtactatgaatggaaccagcaacagcccc
agcggtaaccaccaatcttcttttgccaatagacctcgaaaatcatcagtaaatgggtca
tcagcaacttcttctggttga

DBGET integrated database retrieval system