KEGG   Homo sapiens (human): 10111
Entry
10111             CDS       T01001                                 

Gene name
RAD50, NBSLD, RAD502, hRad50
Definition
(RefSeq) RAD50 double strand break repair protein
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03450  Non-homologous end-joining
hsa04218  Cellular senescence
Disease
H01344  Nijmegen syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    10111 (RAD50)
   03450 Non-homologous end-joining
    10111 (RAD50)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    10111 (RAD50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    10111 (RAD50)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10111 (RAD50)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     10111 (RAD50)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    10111 (RAD50)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     10111 (RAD50)
    BRCA1-C complex
     10111 (RAD50)
   NHEJ (non-homologous end-joining)
    MRX complex
     10111 (RAD50)
SSDB
Motif
Pfam: AAA_23 Rad50_zn_hook AAA_15 SbcCD_C AAA_21 SMC_N Crescentin DUF2703 AAA_29 POTRA_3 AAA_16
Other DBs
NCBI-GeneID: 10111
NCBI-ProteinID: NP_005723
OMIM: 604040
HGNC: 9816
Ensembl: ENSG00000113522
Vega: OTTHUMG00000059613
Pharos: Q92878(Tbio)
UniProt: Q92878 A5D6Y3
LinkDB
Structure
PDB: 
5GOX

Position
5q31.1
AA seq 1312 aa
MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITR
TKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIF
SATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLTSSKEI
VKSYENELDPLKNRLKEIEHNLSKIMKLDNEIKALDSRKKQMEKDNSELEEKMEKVFQGT
DEQLNDLYHNHQRTVREKERKLVDCHRELEKLNKESRLLNQEKSELLVEQGRLQLQADRH
QEHIRARDSLIQSLATQLELDGFERGPFSERQIKNFHKLVRERQEGEAKTANQLMNDFAE
KETLKQKQIDEIRDKKTGLGRIIELKSEILSKKQNELKNVKYELQQLEGSSDRILELDQE
LIKAERELSKAEKNSNVETLKMEVISLQNEKADLDRTLRKLDQEMEQLNHHTTTRTQMEM
LTKDKADKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASSEQNKNHINNELKRKEEQLSSYEDKLFDVCGSQDFESDLDRLKEEIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPVCQRVFQTEAELQEVISDLQSKLRLAPDKLKSTESELK
KKEKRRDEMLGLVPMRQSIIDLKEKEIPELRNKLQNVNRDIQRLKNDIEEQETLLGTIMP
EEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGIDLDRTVQQVNQEKQEKQHKLD
TVSSKIELNRKLIQDQQEQIQHLKSTTNELKSEKLQISTNLQRRQQLEEQTVELSTEVQS
LYREIKDAKEQVSPLETTLEKFQQEKEELINKKNTSNKIAQDKLNDIKEKVKNIHGYMKD
IENYIQDGKDDYKKQKETELNKVIAQLSECEKHKEKINEDMRLMRQDIDTQKIQERWLQD
NLTLRKRNEELKEVEEERKQHLKEMGQMQVLQMKSEHQKLEENIDNIKRNHNLALGRQKG
YEEEIIHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDQAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGIIALDEPTTNLDRENIESLAHALVEIIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRIKKNIDQCSEIVKCSVSSLGFNVH
NT seq 3939 nt   +upstreamnt  +downstreamnt
atgtcccggatcgaaaagatgagcattctgggcgtgcggagttttggaatagaggacaaa
gataagcaaattatcactttcttcagcccccttacaattttggttggacccaatggggcg
ggaaagacgaccatcattgaatgtctaaaatatatttgtactggagatttccctcctgga
accaaaggaaatacatttgtacacgatcccaaggttgctcaagaaacagatgtgagagcc
cagattcgtctgcaatttcgtgatgtcaatggagaacttatagctgtgcaaagatctatg
gtgtgtactcagaaaagcaaaaagacagaatttaaaactctggaaggagtcattactaga
acaaagcatggtgaaaaggtcagtctgagctctaagtgtgcagaaattgaccgagaaatg
atcagttctcttggggtttccaaggctgtgctaaataatgtcattttctgtcatcaagaa
gattctaattggcctttaagtgaaggaaaggctttgaagcaaaagtttgatgagattttt
tcagcaacaagatacattaaagccttagaaacacttcggcaggtacgtcagacacaaggt
cagaaagtaaaagaatatcaaatggaactaaaatatctgaagcaatataaggaaaaagct
tgtgagattcgtgatcagattacaagtaaggaagcccagttaacatcttcaaaggaaatt
gtcaaatcctatgagaatgaacttgatccattgaagaatcgtctaaaagaaattgaacat
aatctctctaaaataatgaaacttgacaatgaaattaaagccttggatagccgaaagaag
caaatggagaaagataatagtgaactggaagagaaaatggaaaaggtttttcaagggact
gatgagcaactaaatgacttatatcacaatcaccagagaacagtaagggagaaagaaagg
aaattggtagactgtcatcgtgaactggaaaaactaaataaagaatctaggcttctcaat
caggaaaaatcagaactgcttgttgaacagggtcgtctacagctgcaagcagatcgccat
caagaacatatccgagctagagattcattaattcagtctttggcaacacagctagaattg
gatggctttgagcgtggaccattcagtgaaagacagattaaaaattttcacaaacttgtg
agagagagacaagaaggggaagcaaaaactgccaaccaactgatgaatgactttgcagaa
aaagagactctgaaacaaaaacagatagatgagataagagataagaaaactggactggga
agaataattgagttaaaatcagaaatcctaagtaagaagcagaatgagctgaaaaatgtg
aagtatgaattacagcagttggaaggatcttcagacaggattcttgaactggaccaggag
ctcataaaagctgaacgtgagttaagcaaggctgagaaaaacagcaatgtagaaacctta
aaaatggaagtaataagtctccaaaatgaaaaagcagacttagacaggaccctgcgtaaa
cttgaccaggagatggagcagttaaaccatcatacaacaacacgtacccaaatggagatg
ctgaccaaagacaaagctgacaaagatgaacaaatcagaaaaataaaatctaggcacagt
gatgaattaacctcactgttgggatattttcccaacaaaaaacagcttgaagactggcta
catagtaaatcaaaagaaattaatcagaccagggacagacttgccaaattgaacaaggaa
ctagcttcatctgagcagaataaaaatcatataaataatgaactaaaaagaaaggaagag
cagttgtccagttacgaagacaagctgtttgatgtttgtggtagccaggattttgaaagt
gatttagacaggcttaaagaggaaattgaaaaatcatcaaaacagcgagccatgctggct
ggagccacagcagtttactcccagttcattactcagctaacagacgaaaaccagtcatgt
tgccccgtttgtcagagagtttttcagacagaggctgagttacaagaagtcatcagtgat
ttgcagtctaaactgcgacttgctccagataaactcaagtcaacagaatcagagctaaaa
aaaaaggaaaagcggcgtgatgaaatgctgggacttgtgcccatgaggcaaagcataatt
gatttgaaggagaaggaaataccagaattaagaaacaaactgcagaatgtcaatagagac
atacagcgcctaaagaacgacatagaagaacaagaaacactcttgggtacaataatgcct
gaagaagaaagtgccaaagtatgcctgacagatgttacaattatggagaggttccagatg
gaacttaaagatgttgaaagaaaaattgcacaacaagcagctaagctacaaggaatagac
ttagatcgaactgtccaacaagtcaaccaggagaaacaagagaaacagcacaagttagac
acagtttctagtaagattgaattgaatcgtaagcttatacaggaccagcaggaacagatt
caacatctaaaaagtacaacaaatgagctaaaatctgagaaacttcagatatccactaat
ttgcaacgtcgtcagcaactggaggagcagactgtggaattatccactgaagttcagtct
ttgtacagagagataaaggatgctaaagagcaggtaagccctttggaaacaacattggaa
aagttccagcaagaaaaagaagaattaatcaacaaaaaaaatacaagcaacaaaatagca
caggataaactgaatgatattaaagagaaggttaaaaatattcatggctatatgaaagac
attgagaattatattcaagatgggaaagacgactataagaagcaaaaagaaactgaactt
aataaagtaatagctcaactaagtgaatgcgagaaacacaaagaaaagataaatgaagat
atgagactcatgagacaagatattgatacacagaagatacaagaaaggtggctacaagat
aaccttactttaagaaaaagaaatgaggaactaaaagaagttgaagaagaaagaaaacaa
catttgaaggaaatgggtcaaatgcaggttttgcaaatgaaaagtgaacatcagaagttg
gaagagaacatagacaatataaaaagaaatcataatttggcattagggcgacagaaaggt
tatgaagaagaaattattcattttaagaaagaacttcgagaaccacaatttcgggatgct
gaggaaaagtatagagaaatgatgattgttatgaggacaacagaacttgtgaacaaggat
ctggatatttattataagactcttgaccaagcaataatgaaatttcacagtatgaaaatg
gaagaaatcaataaaattatacgtgacctgtggcgaagtacctatcgtggacaagatatt
gaatacatagaaatacggtctgatgccgatgaaaatgtatcagcttctgataaaaggcgg
aattataactaccgagtggtgatgctgaagggagacacagccttggatatgcgaggacga
tgcagtgctggacaaaaggtattagcctcactcatcattcgcctggccctggctgaaacg
ttctgcctcaactgtggcatcattgccttggatgagccaacaacaaatcttgaccgagaa
aacattgaatctcttgcacatgctctggttgagataataaaaagtcgctcacagcagcgt
aacttccagcttctggtaatcactcatgatgaagattttgtggagcttttaggacgttct
gaatatgtggagaaattctacaggattaaaaagaacatcgatcagtgctcagagattgtg
aaatgcagtgttagctccctgggattcaatgttcattaa

DBGET integrated database retrieval system