KEGG   Homo sapiens (human): 10274
Entry
10274             CDS       T01001                                 
Symbol
STAG1, MRD47, SA1, SCC3A
Name
(RefSeq) STAG1 cohesin complex component
  KO
K06671  cohesin complex subunit SA-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06512  Chromosome cohesion and segregation
  Element
N01482  Cohesin loading
N01484  Establishment of cohesion
N01485  Cohesin dissociation in prophase
Disease
H00773  Autosomal dominant intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10274 (STAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10274 (STAG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    10274 (STAG1)
SSDB
Motif
Pfam: STAG SCD RFX5_DNA_bdg Cnd3
Other DBs
NCBI-GeneID: 10274
NCBI-ProteinID: NP_005853
OMIM: 604358
HGNC: 11354
Ensembl: ENSG00000118007
LinkDB
Position
3:complement(136336236..136752378)
AA seq 1258 aa
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVKSFLAVCQQCL
SNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDY
GDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFA
LTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKK
TVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKG
RPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEH
GSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLMEEDAEPIFED
VMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgattacttcagaattaccagtgttacaggattcaactaatgaaactactgcccattcc
gatgctggcagcgagcttgaagaaacagaggtcaaaggaaaaagaaaaaggggtcgtcct
ggccggcctccatctacaaataagaaacctcgaaaatctccaggtgagaagagcagaatt
gaagctggaattagaggagcaggccgtggaagagctaatggacaccctcaacagaatggg
gaaggggagcctgtcacattatttgaggtggtgaaactggggaaaagtgcaatgcagtcc
gtggtggatgactggattgaatcatataaacaagacagggacatcgcacttctggattta
atcaacttttttatccagtgttcaggatgtcgaggtactgtgagaatagagatgtttcga
aatatgcagaatgcagaaatcatcagaaaaatgactgaagaatttgatgaggacagtggt
gattatcctcttaccatgcctggacctcagtggaaaaaatttcgttcaaacttttgtgaa
tttattggagtcctgattcgacagtgtcagtatagcataatttatgatgagtatatgatg
gacacagtaatctcccttttgacgggtttgtcagactcccaggtcagagcttttaggcat
acaagtaccctggctgccatgaagctcatgactgctctggtgaatgttgccttaaacctc
agtattcatcaggataatacccagagacaatatgaagccgagagaaataaaatgattggg
aagagagccaatgaaaggttggagttactacttcagaaacgcaaagagctgcaagaaaat
caggatgaaatcgaaaatatgatgaactctatttttaagggtatatttgttcatagatac
cgtgatgctattgctgagattagagccatttgtattgaagaaattggagtatggatgaaa
atgtatagtgatgccttcctaaatgacagttacctaaaatatgttggctggactcttcat
gacaggcaaggggaagtcaggctgaagtgtttgaaagctctgcagagtctatataccaat
agagaattattccccaaattggaactattcactaaccgattcaaggatcgcattgtatca
atgacacttgataaagaatatgatgttgctgtggaagctattcgattggttactctgata
cttcatggaagtgaagaagctctttccaatgaagactgtgaaaatgtttaccacttggtg
tactcggcacatcgccctgttgctgtggcagctggagagttccttcacaaaaagctattt
agcagacatgacccacaagcagaagaagcattagcaaagaggaggggaagaaacagcccg
aatggaaacctcattaggatgctggttcttttctttcttgaaagtgagttacatgaacat
gcagcctacttggtggacagtttatgggagagctctcaagaactgttgaaagactgggaa
tgtatgacagagttgctattagaagaacctgttcaaggagaggaagcaatgtctgatcgt
caagagagtgctcttatagagctaatggtttgtacaattcgtcaagctgctgaggcacat
cctccagtgggaaggggtaccggcaagagagtgctaactgccaaagaaaggaaaactcaa
attgatgatagaaacaaattgactgaacattttattattacacttcctatgttactgtca
aagtattctgcagatgcagagaaggtagcaaacttgctacaaatcccacagtattttgat
ttagaaatctacagcacaggtagaatggaaaagcatctggatgctttattaaaacagatt
aagtttgttgtggagaaacacgtagaatcagatgttctagaagcctgcagtaaaacctat
agtatcttatgcagtgaagaatataccatccagaacagagttgacatagctcgaagccag
ctgattgatgagtttgtagatcgattcaatcattctgtggaagacctattgcaagaggga
gaagaagctgatgatgatgacatttacaatgttctttctacattaaagcggttaacttct
tttcacaatgcacatgatctcacaaaatgggatctctttggtaattgctacagattattg
aagactggaattgaacatggagccatgccagaacagatagtcgtgcaagcactgcagtgt
tcccattattcgattctttggcagttggtgaaaattactgatggctctccttccaaagag
gatttgttggtattgaggaaaacggtgaaatcctttttggctgtttgccagcagtgcctg
tctaatgttaatactccagtgaaagaacaggctttcatgttactctgtgatcttctgatg
attttcagccaccaattaatgacaggtggcagagagggccttcagcctttggtgttcaat
ccagatactggactccaatctgaactcctcagttttgtgatggatcacgtttttattgac
caagacgaggagaaccagagcatggagggtgatgaagaagatgaagctaataaaattgag
gccttacataaaagaaggaatctacttgctgctttcagcaaacttatcatttatgacatt
gttgacatgcatgcagctgcagacatcttcaaacactacatgaagtattacaatgactat
ggtgatattattaaggaaacactgagtaaaaccaggcagattgataaaattcagtgtgcc
aagactctcattctcagtttgcaacagttatttaatgaacttgttcaagagcaaggtccc
aacctagataggacatctgcccatgtcagtggcattaaagaactggcacgtcgctttgcc
cttacatttggattggaccagattaagacacgagaagcagttgccacacttcacaaggat
ggcatagagtttgcatttaaataccaaaatcagaaaggacaagagtatccacctcctaat
ctggcttttcttgaagtactaagtgaattttcttctaaacttcttcgacaggacaaaaag
acagttcattcatacctagagaaattccttaccgagcagatgatggaaaggagggaggat
gtatggcttccactcatctcctatagaaattcattagtcactgggggtgaagatgataga
atgtctgtgaacagtggaagtagcagcagcaaaacctcatcagtaaggaataagaaagga
cgacctccacttcataaaaaacgagtagaagatgagagtctggataacacatggctaaac
aggactgacaccatgattcagactcctggccccctgccagcaccacaactcacatccact
gtactgcgggagaacagtcggcccatgggagaccagattcaagaacctgagtctgaacat
ggttctgaaccagactttttacacaatcctcagatgcagatctcttggttaggccagccg
aagttagaagacttaaatcggaaggacagaacaggaatgaactacatgaaagtgagaact
ggagtgaggcatgctgttcggggtctaatggaggaagatgctgagcccatctttgaagat
gtgatgatgtcatcccgaagccagttagaagatatgaatgaagaatttgaggacaccatg
gttattgatctgcctccatcaagaaatcggcgagagagagctgagctaaggccagacttc
tttgactctgcagctatcatagaagatgattcaggatttggaatgcctatgttctga

DBGET integrated database retrieval system