KEGG   Homo sapiens (human): 10274
Entry
10274             CDS       T01001                                 
Symbol
STAG1, MRD47, SA1, SCC3A
Name
(RefSeq) stromal antigen 1
  KO
K06671  cohesin complex subunit SA-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H00773  Autosomal dominant intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10274 (STAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10274 (STAG1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    10274 (STAG1)
SSDB
Motif
Pfam: STAG Cnd1 RFX5_DNA_bdg Cnd3
Other DBs
NCBI-GeneID: 10274
NCBI-ProteinID: NP_005853
OMIM: 604358
HGNC: 11354
Ensembl: ENSG00000118007
Vega: OTTHUMG00000159798
Pharos: Q8WVM7(Tbio)
UniProt: Q8WVM7 Q4LE48
Structure
LinkDB
Position
3:complement(136336236..136752378)
AA seq 1258 aa
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVKSFLAVCQQCL
SNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDY
GDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFA
LTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKK
TVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKG
RPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEH
GSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLMEEDAEPIFED
VMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
NT seq 3777 nt   +upstreamnt  +downstreamnt
atgattacttcagaattaccagtgttacaggattcaactaatgaaactactgcccattcc
gatgctggcagcgagcttgaagaaacagaggtcaaaggaaaaagaaaaaggggtcgtcct
ggccggcctccatctacaaataagaaacctcgaaaatctccaggtgagaagagcagaatt
gaagctggaattagaggagcaggccgtggaagagctaatggacaccctcaacagaatggg
gaaggggagcctgtcacattatttgaggtggtgaaactggggaaaagtgcaatgcagtcc
gtggtggatgactggattgaatcatataaacaagacagggacatcgcacttctggattta
atcaacttttttatccagtgttcaggatgtcgaggtactgtgagaatagagatgtttcga
aatatgcagaatgcagaaatcatcagaaaaatgactgaagaatttgatgaggacagtggt
gattatcctcttaccatgcctggacctcagtggaaaaaatttcgttcaaacttttgtgaa
tttattggagtcctgattcgacagtgtcagtatagcataatttatgatgagtatatgatg
gacacagtaatctcccttttgacgggtttgtcagactcccaggtcagagcttttaggcat
acaagtaccctggctgccatgaagctcatgactgctctggtgaatgttgccttaaacctc
agtattcatcaggataatacccagagacaatatgaagccgagagaaataaaatgattggg
aagagagccaatgaaaggttggagttactacttcagaaacgcaaagagctgcaagaaaat
caggatgaaatcgaaaatatgatgaactctatttttaagggtatatttgttcatagatac
cgtgatgctattgctgagattagagccatttgtattgaagaaattggagtatggatgaaa
atgtatagtgatgccttcctaaatgacagttacctaaaatatgttggctggactcttcat
gacaggcaaggggaagtcaggctgaagtgtttgaaagctctgcagagtctatataccaat
agagaattattccccaaattggaactattcactaaccgattcaaggatcgcattgtatca
atgacacttgataaagaatatgatgttgctgtggaagctattcgattggttactctgata
cttcatggaagtgaagaagctctttccaatgaagactgtgaaaatgtttaccacttggtg
tactcggcacatcgccctgttgctgtggcagctggagagttccttcacaaaaagctattt
agcagacatgacccacaagcagaagaagcattagcaaagaggaggggaagaaacagcccg
aatggaaacctcattaggatgctggttcttttctttcttgaaagtgagttacatgaacat
gcagcctacttggtggacagtttatgggagagctctcaagaactgttgaaagactgggaa
tgtatgacagagttgctattagaagaacctgttcaaggagaggaagcaatgtctgatcgt
caagagagtgctcttatagagctaatggtttgtacaattcgtcaagctgctgaggcacat
cctccagtgggaaggggtaccggcaagagagtgctaactgccaaagaaaggaaaactcaa
attgatgatagaaacaaattgactgaacattttattattacacttcctatgttactgtca
aagtattctgcagatgcagagaaggtagcaaacttgctacaaatcccacagtattttgat
ttagaaatctacagcacaggtagaatggaaaagcatctggatgctttattaaaacagatt
aagtttgttgtggagaaacacgtagaatcagatgttctagaagcctgcagtaaaacctat
agtatcttatgcagtgaagaatataccatccagaacagagttgacatagctcgaagccag
ctgattgatgagtttgtagatcgattcaatcattctgtggaagacctattgcaagaggga
gaagaagctgatgatgatgacatttacaatgttctttctacattaaagcggttaacttct
tttcacaatgcacatgatctcacaaaatgggatctctttggtaattgctacagattattg
aagactggaattgaacatggagccatgccagaacagatagtcgtgcaagcactgcagtgt
tcccattattcgattctttggcagttggtgaaaattactgatggctctccttccaaagag
gatttgttggtattgaggaaaacggtgaaatcctttttggctgtttgccagcagtgcctg
tctaatgttaatactccagtgaaagaacaggctttcatgttactctgtgatcttctgatg
attttcagccaccaattaatgacaggtggcagagagggccttcagcctttggtgttcaat
ccagatactggactccaatctgaactcctcagttttgtgatggatcacgtttttattgac
caagacgaggagaaccagagcatggagggtgatgaagaagatgaagctaataaaattgag
gccttacataaaagaaggaatctacttgctgctttcagcaaacttatcatttatgacatt
gttgacatgcatgcagctgcagacatcttcaaacactacatgaagtattacaatgactat
ggtgatattattaaggaaacactgagtaaaaccaggcagattgataaaattcagtgtgcc
aagactctcattctcagtttgcaacagttatttaatgaacttgttcaagagcaaggtccc
aacctagataggacatctgcccatgtcagtggcattaaagaactggcacgtcgctttgcc
cttacatttggattggaccagattaagacacgagaagcagttgccacacttcacaaggat
ggcatagagtttgcatttaaataccaaaatcagaaaggacaagagtatccacctcctaat
ctggcttttcttgaagtactaagtgaattttcttctaaacttcttcgacaggacaaaaag
acagttcattcatacctagagaaattccttaccgagcagatgatggaaaggagggaggat
gtatggcttccactcatctcctatagaaattcattagtcactgggggtgaagatgataga
atgtctgtgaacagtggaagtagcagcagcaaaacctcatcagtaaggaataagaaagga
cgacctccacttcataaaaaacgagtagaagatgagagtctggataacacatggctaaac
aggactgacaccatgattcagactcctggccccctgccagcaccacaactcacatccact
gtactgcgggagaacagtcggcccatgggagaccagattcaagaacctgagtctgaacat
ggttctgaaccagactttttacacaatcctcagatgcagatctcttggttaggccagccg
aagttagaagacttaaatcggaaggacagaacaggaatgaactacatgaaagtgagaact
ggagtgaggcatgctgttcggggtctaatggaggaagatgctgagcccatctttgaagat
gtgatgatgtcatcccgaagccagttagaagatatgaatgaagaatttgaggacaccatg
gttattgatctgcctccatcaagaaatcggcgagagagagctgagctaaggccagacttc
tttgactctgcagctatcatagaagatgattcaggatttggaatgcctatgttctga

KEGG   Homo sapiens (human): 10735
Entry
10735             CDS       T01001                                 
Symbol
STAG2, HPE13, MKMS, NEDXCF, SA-2, SA2, SCC3B, bA517O1.1
Name
(RefSeq) stromal antigen 2
  KO
K06671  cohesin complex subunit SA-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10735 (STAG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10735 (STAG2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    10735 (STAG2)
SSDB
Motif
Pfam: STAG Cnd3 AdoHcyase_NAD MyTH4
Other DBs
NCBI-GeneID: 10735
NCBI-ProteinID: NP_001036216
OMIM: 300826
HGNC: 11355
Ensembl: ENSG00000101972
Vega: OTTHUMG00000022725
Pharos: Q8N3U4(Tbio)
UniProt: Q8N3U4 Q6MZM3
Structure
LinkDB
Position
X:123960560..124102656
AA seq 1231 aa
MIAAPEIPTDFNLLQESETHFSSDTDFEDIEGKNQKQGKGKTCKKGKKGPAEKGKGGNGG
GKPPSGPNRMNGHHQQNGVENMMLFEVVKMGKSAMQSVVDDWIESYKHDRDIALLDLINF
FIQCSGCKGVVTAEMFRHMQNSEIIRKMTEEFDEDSGDYPLTMAGPQWKKFKSSFCEFIG
VLVRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIN
MDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNAIFKGVFVHRYRDA
IAEIRAICIEEIGIWMKMYSDAFLNDSYLKYVGWTMHDKQGEVRLKCLTALQGLYYNKEL
NSKLELFTSRFKDRIVSMTLDKEYDVAVQAIKLLTLVLQSSEEVLTAEDCENVYHLVYSA
HRPVAVAAGEFLYKKLFSRRDPEEDGMMKRRGRQGPNANLVKTLVFFFLESELHEHAAYL
VDSMWDCATELLKDWECMNSLLLEEPLSGEEALTDRQESALIEIMLCTIRQAAECHPPVG
RGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIY
TTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDE
LADKFNRLLEDFLQEGEEPDEDDAYQVLSTLKRITAFHNAHDLSKWDLFACNYKLLKTGI
ENGDMPEQIVIHALQCTHYVILWQLAKITESSSTKEDLLRLKKQMRVFCQICQHYLTNVN
TTVKEQAFTILCDILMIFSHQIMSGGRDMLEPLVYTPDSSLQSELLSFILDHVFIEQDDD
NNSADGQQEDEASKIEALHKRRNLLAAFCKLIVYTVVEMNTAADIFKQYMKYYNDYGDII
KETMSKTRQIDKIQCAKTLILSLQQLFNEMIQENGYNFDRSSSTFSGIKELARRFALTFG
LDQLKTREAIAMLHKDGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSKLLRQDKRTVYV
YLEKFMTFQMSLRREDVWLPLMSYRNSLLAGGDDDTMSVISGISSRGSTVRSKKSKPSTG
KRKVVEGMQLSLTEESSSSDSMWLSREQTLHTPVMMQTPQLTSTIMREPKRLRPEDSFMS
VYPMQTEHHQTPLDYNRRGTSLMEDDEEPIVEDVMMSSEGRIEDLNEGMDFDTMDIDLPP
SKNRRERTELKPDFFDPASIMDESVLGVSMF
NT seq 3696 nt   +upstreamnt  +downstreamnt
atgatagcagctccagaaataccaactgattttaatctactacaggagtcagaaacacat
ttttcttctgacacagattttgaagatatcgaaggaaaaaaccaaaagcaaggcaaaggc
aaaacttgtaaaaaaggcaaaaagggcccagcagaaaagggcaaaggtggaaatggagga
ggaaaacctccttctggtccaaaccgaatgaatggtcatcaccaacagaatggagtggaa
aacatgatgttgtttgaagttgttaaaatgggcaagagtgctatgcagtcggtggtagat
gattggatagaatcatacaagcatgaccgagatatagcacttcttgaccttatcaacttt
tttattcagtgttcaggctgtaaaggagttgtcacagcagaaatgtttagacatatgcag
aactctgagataattcgaaaaatgactgaagaattcgatgaggatagtggagattatcca
cttaccatggctggtcctcagtggaagaagttcaaatccagtttttgtgaattcattggc
gtgttagtacggcaatgtcaatatagtatcatatatgatgagtatatgatggatacagtc
atttcacttcttacaggattgtctgactcacaagtcagagcatttcgacatacaagcacc
ctggcagctatgaagttgatgacagctttggtgaatgtggcactaaatcttagcattaat
atggataatacacaaagacaatatgaagcagaacggaataaaatgattggaaaacgagcc
aatgagaggctagaactcctgctacaaaagcggaaagagcttcaggaaaatcaagatgaa
atagaaaatatgatgaatgcaatatttaaaggagtgtttgtacatagataccgtgatgcg
atagctgaaattcgagctatttgcattgaagagattggcatttggatgaagatgtatagt
gatgcctttcttaatgacagttatttaaaatatgttggttggactatgcatgataagcaa
ggtgaagtaagactcaaatgtcttactgctctacaagggctttattataacaaagagctt
aattccaaactggaactttttaccagtcggttcaaggatagaattgtgtctatgaccctt
gacaaagaatatgatgttgcagtacaagcaataaaattactcactcttgttttacagagt
agtgaagaagttctcactgcagaagattgtgaaaatgtctatcatctggtttattcagct
caccggccagtagcagtagcagctggagaatttctctacaaaaagctcttcagtcgtaga
gatccagaggaggatggaatgatgaaaagaagaggaagacaaggtccaaatgccaacctt
gttaagacattggtttttttctttctagaaagtgagttacatgagcatgcagcatacctt
gtggatagcatgtgggactgtgctactgagctgctgaaagactgggaatgtatgaatagc
ttgttactggaagagccacttagtggagaggaagcactaacagataggcaagagagtgct
ctgattgaaataatgctttgtaccattagacaagcggctgaatgtcatcctcccgtggga
agagggacaggaaaaagggtgcttacagcaaaggagaagaagacacagttggatgatagg
acaaaaatcactgagctttttgccgtggcccttcctcagttattagcaaaatactctgta
gatgcagaaaaggtgactaacttgttgcagttgcctcagtactttgatttggaaatatat
accactggacgattagaaaagcatttggatgccttattgcgacagatccggaatattgta
gagaagcacacagatacagatgttttggaagcatgttctaaaacttaccatgcactctgt
aatgaagagttcacaatcttcaacagagtagatatttcaagaagtcaactgatagatgaa
ttggcagataaatttaaccggcttcttgaagattttctgcaagagggtgaagaacctgat
gaagatgatgcatatcaggtattgtcaacattgaagaggatcactgcttttcataatgcc
catgacctttcaaagtgggatttatttgcttgtaattacaaactcttgaaaactggaatc
gaaaatggagacatgcctgagcagattgttattcacgcactgcagtgtactcactatgta
atcctttggcaacttgctaagataactgaaagcagctctacaaaggaggacttgctgcgt
ttaaagaaacaaatgagagtattttgtcagatatgtcaacattacctgaccaacgtgaat
actactgttaaggaacaggccttcactattctgtgtgatattttgatgatcttcagccat
cagattatgtcaggagggcgtgacatgttagagccattagtgtatacccctgattcttca
ttgcagtctgagttgctcagctttattttggatcatgtcttcattgaacaggatgatgat
aataatagtgcagatggtcagcaagaggatgaagccagtaaaattgaagctctgcacaag
agaagaaatttacttgcagcattttgtaagctaattgtatatactgtggtggagatgaat
acagctgcagatatcttcaaacagtatatgaagtattataatgactatggagatatcatc
aaagaaacaatgagtaaaacaaggcagatagacaaaattcagtgtgctaagacccttatt
ctcagtctgcaacagctttttaatgaaatgatacaagaaaatggctataattttgataga
tcatcctctacatttagtggcataaaagaacttgctcgacgttttgctttaacttttgga
cttgatcagttgaaaacaagagaagccattgccatgctacacaaagatggcatagaattt
gcttttaaagagcctaatccgcaaggggagagccatccacctttaaatttggcatttctt
gatattctgagtgaattttcttctaaactacttcgacaagacaaaagaacagtgtatgtt
tacttggaaaagttcatgacctttcagatgtcactccgaagagaggatgtgtggcttcca
ctgatgtcttaccgaaattctttgctagctggtggtgatgatgacaccatgtcagtcatt
agtggaatcagcagccgggggtcaacagtacggagtaaaaaatcaaaaccatctacagga
aaacggaaagtggttgagggcatgcagctttcactcactgaagaaagtagtagtagtgac
agtatgtggttaagcagagaacaaacactgcacacccctgttatgatgcagacaccacaa
ctcacctccactattatgagagagcccaaaagattacggcctgaggatagcttcatgagt
gtttatccaatgcagactgaacatcatcaaacacctcttgattataatcggcgtggcaca
agcctaatggaagatgatgaagagccaattgtggaagatgttatgatgtcctcagaaggg
aggattgaggatcttaatgagggaatggattttgacaccatggatatagatttgccacca
tcaaagaacagacgagagagaacagaactgaagcctgatttctttgatccagcttcaatt
atggatgaatcagttcttggagtgtcaatgttttaa

DBGET integrated database retrieval system