Homo sapiens (human): 103910 Help Entry 103910            CDS       T01001                                  Symbol MYL12B, MLC-B, MRLC2 Name (RefSeq) myosin light chain 12B   KO K12757   myosin regulatory light chain 12 Organism hsa  Homo sapiens (human) Pathway hsa04360   Axon guidance hsa04510   Focal adhesion hsa04520   Adherens junction hsa04530   Tight junction hsa04611   Platelet activation hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103910 (MYL12B)    04520 Adherens junction     103910 (MYL12B)    04530 Tight junction     103910 (MYL12B)   09142 Cell motility    04814 Motor proteins     103910 (MYL12B)    04810 Regulation of actin cytoskeleton     103910 (MYL12B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103910 (MYL12B)    04670 Leukocyte transendothelial migration     103910 (MYL12B)   09158 Development and regeneration    04360 Axon guidance     103910 (MYL12B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103910 (MYL12B)    05131 Shigellosis     103910 (MYL12B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     103910 (MYL12B)    04147 Exosome [BR:hsa04147]     103910 (MYL12B) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103910 (MYL12B) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of bladder cancer cells    103910 (MYL12B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF2666 DUF3741 SPARC_Ca_bdg 2-Hacid_dh_C Motif Other DBs NCBI-GeneID:  103910 NCBI-ProteinID:  NP_001138416 OMIM:  609211 HGNC:  29827 Ensembl:  ENSG00000118680 UniProt:  O14950 LinkDB All DBs Position 18:3262133..3278461 Genome browser AA seq 172 aa AA seqDB search MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQE DYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtcgagcaaaaaggcaaagaccaagaccaccaagaagcgccctcagcgtgcaacatcc aatgtgtttgccatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatg attgatcagaacagagatggcttcatcgacaaggaagatttgcatgatatgcttgcttct ctagggaagaatcccactgatgcataccttgatgccatgatgaatgaggccccagggccc atcaatttcaccatgttcctgaccatgtttggtgagaagttaaatggcacagatcctgaa gatgtcatcagaaacgcctttgcttgctttgatgaagaagcaacaggcaccattcaggaa gattacctaagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggat gagctgtacagagaagcacctattgacaaaaaggggaatttcaattacatcgagttcaca cgcatcctgaaacatggagccaaagacaaagatgactga

Homo sapiens (human): 10398 Help Entry 10398             CDS       T01001                                  Symbol MYL9, LC20, MLC-2C, MLC2, MMIHS4, MRLC1, MYRL2 Name (RefSeq) myosin light chain 9   KO K12755   myosin regulatory light chain 9 Organism hsa  Homo sapiens (human) Pathway hsa04022   cGMP-PKG signaling pathway hsa04024   cAMP signaling pathway hsa04270   Vascular smooth muscle contraction hsa04360   Axon guidance hsa04510   Focal adhesion hsa04520   Adherens junction hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa04921   Oxytocin signaling pathway hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Disease H01869   Megacystis microcolon intestinal hypoperistalsis syndrome Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     10398 (MYL9)    04022 cGMP-PKG signaling pathway     10398 (MYL9)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     10398 (MYL9)    04520 Adherens junction     10398 (MYL9)    04530 Tight junction     10398 (MYL9)   09142 Cell motility    04814 Motor proteins     10398 (MYL9)    04810 Regulation of actin cytoskeleton     10398 (MYL9)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     10398 (MYL9)   09152 Endocrine system    04921 Oxytocin signaling pathway     10398 (MYL9)   09153 Circulatory system    04270 Vascular smooth muscle contraction     10398 (MYL9)   09158 Development and regeneration    04360 Axon guidance     10398 (MYL9)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     10398 (MYL9)    05131 Shigellosis     10398 (MYL9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     10398 (MYL9)    04147 Exosome [BR:hsa04147]     10398 (MYL9) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      10398 (MYL9) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of hepatic cells    10398 (MYL9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH DUF3741 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  10398 NCBI-ProteinID:  NP_006088 OMIM:  609905 HGNC:  15754 Ensembl:  ENSG00000101335 UniProt:  P24844 A0A384NY64 LinkDB All DBs Position 20:36541519..36551447 Genome browser AA seq 172 aa AA seqDB search MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaagcgggccaaagccaagaccaccaagaagcggccacagcgggccacatcc aatgtcttcgcaatgtttgaccagtcccagatccaggagtttaaggaggctttcaacatg attgaccagaaccgtgatggcttcattgacaaggaggacctgcacgacatgctggcctcg ctggggaagaaccccacagacgaatacctggagggcatgatgagcgaggccccggggccc atcaacttcaccatgttcctcaccatgtttggggagaagctgaacggcacggaccccgag gatgtgattcgcaacgcctttgcctgcttcgacgaggaagcctcaggtttcatccatgag gaccacctccgggagctgctcaccaccatgggtgaccgcttcacagatgaggaagtggac gagatgtaccgggaggcacccattgataagaaaggcaacttcaactacgtggagttcacc cgcatcctcaaacatggcgccaaggataaagacgactag

Homo sapiens (human): 10627 Help Entry 10627             CDS       T01001                                  Symbol MYL12A, HEL-S-24, MLC-2B, MLCB, MRCL3, MRLC3, MYL2B Name (RefSeq) myosin light chain 12A   KO K12757   myosin regulatory light chain 12 Organism hsa  Homo sapiens (human) Pathway hsa04360   Axon guidance hsa04510   Focal adhesion hsa04520   Adherens junction hsa04530   Tight junction hsa04611   Platelet activation hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     10627 (MYL12A)    04520 Adherens junction     10627 (MYL12A)    04530 Tight junction     10627 (MYL12A)   09142 Cell motility    04814 Motor proteins     10627 (MYL12A)    04810 Regulation of actin cytoskeleton     10627 (MYL12A)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     10627 (MYL12A)    04670 Leukocyte transendothelial migration     10627 (MYL12A)   09158 Development and regeneration    04360 Axon guidance     10627 (MYL12A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     10627 (MYL12A)    05131 Shigellosis     10627 (MYL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     10627 (MYL12A)    04147 Exosome [BR:hsa04147]     10627 (MYL12A) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      10627 (MYL12A) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of bladder cancer cells    10627 (MYL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_11 EF-hand_5 EF-hand_9 DUF3741 DUF2666 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  10627 NCBI-ProteinID:  NP_001289976 HGNC:  16701 Ensembl:  ENSG00000101608 UniProt:  P19105 LinkDB All DBs Position 18:3247482..3256237 Genome browser AA seq 171 aa AA seqDB search MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgtcgagcaaaagaacaaagaccaagaccaagaagcgccctcagcgtgcaacatccaat gtgtttgctatgtttgaccagtcacagattcaggagttcaaagaggccttcaacatgatt gatcagaacagagatggtttcatcgacaaggaagatttgcatgatatgcttgcttcattg gggaagaatccaactgatgagtatctagatgccatgatgaatgaggctccaggccccatc aatttcaccatgttcctcaccatgtttggtgagaagttaaatggcacagatcctgaagat gtcatcagaaatgcctttgcttgctttgatgaagaagcaactggcaccatacaggaagat tacttgagagagctgctgacaaccatgggggatcggtttacagatgaggaagtggatgag ctgtacagagaagcacctattgataaaaaggggaatttcaattacatcgagttcacacgc atcctgaaacatggagccaaagacaaagatgactga

Homo sapiens (human): 29895 Help Entry 29895             CDS       T01001                                  Symbol MYL11, DA1C, HUMMLC2B, MLC2B, MRLC2, MYLPF Name (RefSeq) myosin light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism hsa  Homo sapiens (human) Pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Disease H00811   Distal arthrogryposis Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     29895 (MYL11)    04520 Adherens junction     29895 (MYL11)   09142 Cell motility    04814 Motor proteins     29895 (MYL11)    04810 Regulation of actin cytoskeleton     29895 (MYL11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     29895 (MYL11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     29895 (MYL11)    05131 Shigellosis     29895 (MYL11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     29895 (MYL11)    04147 Exosome [BR:hsa04147]     29895 (MYL11) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      29895 (MYL11) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of hepatic cells    29895 (MYL11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 Motif Other DBs NCBI-GeneID:  29895 NCBI-ProteinID:  NP_001311387 OMIM:  617378 HGNC:  29824 Ensembl:  ENSG00000180209 UniProt:  Q96A32 LinkDB All DBs Position 16:30370934..30377991 Genome browser AA seq 169 aa AA seqDB search MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc accggagccttcaaggtcttggaccctgagggaaagggcaccatcaagaagaagttcctg gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc acgcacggcgacgccaaggaccaggagtag

Homo sapiens (human): 4633 Help Entry 4633              CDS       T01001                                  Symbol MYL2, CMH10, MFM12, MLC-2, MLC-2s/v, MLC-2v, MLC2 Name (RefSeq) myosin light chain 2   KO K10351   myosin regulatory light chain 2 Organism hsa  Homo sapiens (human) Pathway hsa04260   Cardiac muscle contraction hsa04261   Adrenergic signaling in cardiomyocytes hsa04371   Apelin signaling pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection hsa05410   Hypertrophic cardiomyopathy hsa05414   Dilated cardiomyopathy Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Disease H00292   Hypertrophic cardiomyopathy H00595   Myofibrillar myopathies Drug target Aficamten:  D12253 Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     4633 (MYL2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     4633 (MYL2)    04520 Adherens junction     4633 (MYL2)    04530 Tight junction     4633 (MYL2)   09142 Cell motility    04814 Motor proteins     4633 (MYL2)    04810 Regulation of actin cytoskeleton     4633 (MYL2)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     4633 (MYL2)   09153 Circulatory system    04260 Cardiac muscle contraction     4633 (MYL2)    04261 Adrenergic signaling in cardiomyocytes     4633 (MYL2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     4633 (MYL2)    05131 Shigellosis     4633 (MYL2)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     4633 (MYL2)    05414 Dilated cardiomyopathy     4633 (MYL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     4633 (MYL2) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      4633 (MYL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 Motif Other DBs NCBI-GeneID:  4633 NCBI-ProteinID:  NP_000423 OMIM:  160781 HGNC:  7583 Ensembl:  ENSG00000111245 UniProt:  P10916 Q6IB42 Structure PDB LinkDB All DBs Position 12:complement(110910845..110921449) Genome browser AA seq 166 aa AA seqDB search MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc cacggagaagagaaggactag

Homo sapiens (human): 4636 Help Entry 4636              CDS       T01001                                  Symbol MYL5, MYLC2 Name (RefSeq) myosin light chain 5   KO K12753   myosin regulatory light chain 5 Organism hsa  Homo sapiens (human) Pathway hsa04360   Axon guidance hsa04510   Focal adhesion hsa04520   Adherens junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     4636 (MYL5)    04520 Adherens junction     4636 (MYL5)   09142 Cell motility    04814 Motor proteins     4636 (MYL5)    04810 Regulation of actin cytoskeleton     4636 (MYL5)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     4636 (MYL5)   09158 Development and regeneration    04360 Axon guidance     4636 (MYL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     4636 (MYL5)    05131 Shigellosis     4636 (MYL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     4636 (MYL5) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      4636 (MYL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 Lipoprotein_6 Caleosin SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  4636 NCBI-ProteinID:  NP_002468 OMIM:  160782 HGNC:  7586 Ensembl:  ENSG00000215375 UniProt:  Q02045 LinkDB All DBs Position 4:674542..682028 Genome browser AA seq 173 aa AA seqDB search MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaagaccaagaagaaggaagggggtgccctccgggcccagagagcctca tccaatgtcttctccaactttgagcagactcagatccaggagttcaaggaggcattcaca ctcatggatcagaaccgagatggcttcattgacaaggaggacctgaaggacacctatgcc tccctgggcaagaccaacgtcaaggacgacgagctggacgccatgctcaaagaggcctcg gggcccatcaacttcaccatgtttctgaacctgtttggggagaagctgagcggtaccgac gccgaggagaccattcttaacgccttcaagatgctggacccggacgggaaagggaaaatc aacaaggagtacatcaagcgtctgctgatgtcccaggctgacaagatgacggcggaagag gtggaccagatgttccagttcgcctccatcgatgtggcgggcaacctggactacaaggcg ctcagctacgtgatcacccacggggaggagaaggaggagtga

Homo sapiens (human): 58498 Help Entry 58498             CDS       T01001                                  Symbol MYL7, MYL2A, MYLC2A Name (RefSeq) myosin light chain 7   KO K12754   myosin regulatory light chain 7 Organism hsa  Homo sapiens (human) Pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     58498 (MYL7)    04520 Adherens junction     58498 (MYL7)   09142 Cell motility    04814 Motor proteins     58498 (MYL7)    04810 Regulation of actin cytoskeleton     58498 (MYL7)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     58498 (MYL7)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     58498 (MYL7)    05131 Shigellosis     58498 (MYL7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     58498 (MYL7) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      58498 (MYL7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 CHCH EF-hand_9 Motif Other DBs NCBI-GeneID:  58498 NCBI-ProteinID:  NP_067046 OMIM:  613993 HGNC:  21719 Ensembl:  ENSG00000106631 UniProt:  Q01449 LinkDB All DBs Position 7:complement(44138864..44141332) Genome browser AA seq 175 aa AA seqDB search MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggaaggcggggacccggggcaaggtggcagccaccaagcaggcccaacgt ggttcttccaacgtcttttccatgtttgaacaagcccagatacaggagttcaaagaagcc ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaagag ggcaagggccccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagcggcaaaggg gtggtgaacaaggatgagttcaagcagcttctcctgacccaggcagacaagttctctcca gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

Homo sapiens (human): 93408 Help Entry 93408             CDS       T01001                                  Symbol MYL10, MYLC2PL, PLRLC Name (RefSeq) myosin light chain 10   KO K12756   myosin regulatory light chain 10 Organism hsa  Homo sapiens (human) Pathway hsa04510   Focal adhesion hsa04520   Adherens junction hsa04670   Leukocyte transendothelial migration hsa04810   Regulation of actin cytoskeleton hsa04814   Motor proteins hsa05131   Shigellosis hsa05132   Salmonella infection Network nt06135  Cytoskeletal regulation (viruses and bacteria)   Element N01074   Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway N01130   Salmonella SopB to RhoA signaling pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     93408 (MYL10)    04520 Adherens junction     93408 (MYL10)   09142 Cell motility    04814 Motor proteins     93408 (MYL10)    04810 Regulation of actin cytoskeleton     93408 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     93408 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     93408 (MYL10)    05131 Shigellosis     93408 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hsa04812]     93408 (MYL10) Cytoskeleton proteins [BR:hsa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      93408 (MYL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_1 EF-hand_5 TC1 Motif Other DBs NCBI-GeneID:  93408 NCBI-ProteinID:  NP_612412 OMIM:  617177 HGNC:  29825 Ensembl:  ENSG00000106436 UniProt:  Q9BUA6 LinkDB All DBs Position 7:complement(101613330..101629296) Genome browser AA seq 226 aa AA seqDB search MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLA LSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRIN VKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIK EKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atgttgcttaggctggtctcaaactcctggcctcaagtgatcctccctcctcggcctccc aaagtgctgggattacaggcaccgagaagagctcggaaaagagcagaaggcaccgccagc tccaacgtcttctccatgtttgatcagtcccagatccaggagtttaaagagagtctggct ctgtcgcccaggctggagcgcaatggcatgatctcggctcactgcaacctctgcctcacg ggttcaagcaattctcctgcctcagcctcccaagctttcaccatcatggaccagaaccgt gatggcttcatcgacaaagaggacttgagggacacctttgccgcgctgggccgcatcaat gtcaagaacgaggaactggaggccatggtgaaggaggcccccggacccatcaacttcacg gtgttcctgaccatgtttggggagaagctgaagggcacggacccagaggagaccattctc cacgccttcaaagtgttcgacactgaagggaaaggtttcgtcaaggccgatgtcatcaaa gaaaaacttatgacccaggcagaccgcttcagtgaggaggaggtcaagcagatgtttgca gcatttcccccagatgtgtgcggcaacctggactacagaaacctgtgctacgtcatcact cacggtgaagagaaggattag

DBGET integrated database retrieval system