KEGG   Homo sapiens (human): 10403
Entry
10403             CDS       T01001                                 
Symbol
NDC80, HEC, HEC1, HsHec1, KNTC2, TID3, hsNDC80
Name
(RefSeq) NDC80 kinetochore complex component
  KO
K11547  kinetochore protein NDC80
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06515  Regulation of kinetochore-microtubule interactions
  Element
N01526  Organization of the outer kinetochore
N01529  Recruitment and formation of the MCC
N01531  CENPE interaction with NDC80 complex
N01536  Dephosphorylation of kinetochore
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10403 (NDC80)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10403 (NDC80)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     NDC80 complex
      10403 (NDC80)
    NMS complex
      10403 (NDC80)
SSDB
Motif
Pfam: Ndc80_HEC DUF5595 ADIP DUF1664 bZIP_1 DUF6468 SlyX HrpB7 Muted
Other DBs
NCBI-GeneID: 10403
NCBI-ProteinID: NP_006092
OMIM: 607272
HGNC: 16909
Ensembl: ENSG00000080986
UniProt: O14777 A8K031
Structure
LinkDB
Position
18:2571557..2616635
AA seq 642 aa
MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKR
TSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAP
SVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPH
IVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGA
DSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK
ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQK
YSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLAR
KLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKM
GLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKH
LLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL
EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgaagcgcagttcagtttccagcggtggtgctggccgcctctccatgcaggagttaaga
tcccaggatgtaaataaacaaggcctctatacccctcaaaccaaagagaaaccaaccttt
ggaaagttgagtataaacaaaccgacatctgaaagaaaagtctcgctatttggcaaaaga
actagtggacatggatcccggaatagtcaacttggtatattttccagttctgagaaaatc
aaggacccgagaccacttaatgacaaagcattcattcagcagtgtattcgacaactctgt
gagtttcttacagaaaatggttatgcacataatgtgtccatgaaatctctacaagctccc
tctgttaaagacttcctgaagatcttcacatttctttatggcttcctgtgcccctcatac
gaacttcctgacacaaagtttgaagaagaggttccaagaatctttaaagaccttgggtat
ccttttgcactatccaaaagctccatgtacacagtgggggctcctcatacatggcctcac
attgtggcagccttagtttggctaatagactgcatcaagatacatactgccatgaaagaa
agctcacctttatttgatgatgggcagccttggggagaagaaactgaagatggaattatg
cataataagttgtttttggactacaccataaaatgctatgagagttttatgagtggtgcc
gacagctttgatgagatgaatgcagagctgcagtcaaaactgaaggatttatttaatgtg
gatgcttttaagctggaatcattagaagcaaaaaacagagcattgaatgaacagattgca
agattggaacaagaaagagaaaaagaaccgaatcgtctagagtcgttgagaaaactgaag
gcttccttacaaggagatgttcaaaagtatcaggcatacatgagcaatttggagtctcat
tcagccattcttgaccagaaattaaatggtctcaatgaggaaattgctagagtagaacta
gaatgtgaaacaataaaacaggagaacactcgactacagaatatcattgacaaccagaag
tactcagttgcagacattgagcgaataaatcatgaaagaaatgaattgcagcagactatt
aataaattaaccaaggacctggaagctgaacaacagaagttgtggaatgaggagttaaaa
tatgccagaggcaaagaagcgattgaaacacaattagcagagtatcacaaattggctaga
aaattaaaacttattcctaaaggtgctgagaattccaaaggttatgactttgaaattaag
tttaatcccgaggctggtgccaactgccttgtcaaatacagggctcaagtttatgtacct
cttaaggaactcctgaatgaaactgaagaagaaattaataaagccctaaataaaaaaatg
ggtttggaggatactttagaacaattgaatgcaatgataacagaaagcaagagaagtgtg
agaactctgaaagaagaagttcaaaagctggatgatctttaccaacaaaaaattaaggaa
gcagaggaagaggatgaaaaatgtgccagtgagcttgagtccttggagaaacacaagcac
ctgctagaaagtactgttaaccaggggctcagtgaagctatgaatgaattagatgctgtt
cagcgggaataccaactagttgtgcaaaccacgactgaagaaagacgaaaagtgggaaat
aacttgcaacgtctgttagagatggttgctacacatgttgggtctgtagagaaacatctt
gaggagcagattgctaaagttgatagagaatatgaagaatgcatgtcagaagatctctcg
gaaaatattaaagagattagagataagtatgagaagaaagctactctaattaagtcttct
gaagaatga

DBGET integrated database retrieval system