KEGG   Homo sapiens (human): 10594
Entry
10594             CDS       T01001                                 
Symbol
PRPF8, HPRP8, PRP8, PRPC8, RP13, SNRNP220
Name
(RefSeq) pre-mRNA processing factor 8
  KO
K12856  pre-mRNA-processing factor 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10594 (PRPF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10594 (PRPF8)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    10594 (PRPF8)
 Complex C
   U5 SnRNP specific factors
    10594 (PRPF8)
SSDB
Motif
Pfam: PROCN PRP8_domainIV U6-snRNA_bdg PRO8NT U5_2-snRNA_bdg PROCT RRM_4 JAB
Other DBs
NCBI-GeneID: 10594
NCBI-ProteinID: NP_006436
OMIM: 607300
HGNC: 17340
Ensembl: ENSG00000174231
Pharos: Q6P2Q9(Tbio)
UniProt: Q6P2Q9
Structure
LinkDB
Position
17:complement(1650629..1684867)
AA seq 2335 aa
MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKED
MPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLY
HITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYAD
NILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDIN
KIIIRQPIRTEYKIAFPYLYNNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPIS
HRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTANGIALLWAPRPFNLRSGRTRR
ALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRF
GNAFHLCREVLRLTKLVVDSHVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMR
QIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFFMRGITPLLERWLGNLLARQF
EGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLT
RLYLKAEQERQHNYLKDGPYITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLI
LALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSRIKRHLLTQRAFKEVGIEFMD
LYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYK
DMNHTNSYGIIRGLQFASFIVQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATE
AAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDPNNENIVGYNNKKCWPRDARM
RLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIV
NKWNTALIGLMTYFREAVVNTQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPK
ELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHEEDQLIPNLYRYIQPWESEFI
DSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEG
LFWEKASGFEESMKWKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGI
FMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQELDALEIETVQKETIHPRKSY
KMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPAL
YVLRERIRKGLQLYSSEPTEPYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTT
KPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQ
IIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVE
VQLKDLILADYGKKNNVNVASLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLT
ATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISAANLHLRTNHIYVSSDDIKET
GYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTP
GSCTLTAYKLTPSGYEWGRQNTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWN
YNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALLQEGEVYSADREDLYA
NT seq 7008 nt   +upstreamnt  +downstreamnt
atggccggagtgtttccttatcgagggccgggtaacccggtgcctggccctctagccccg
ctaccggactacatgtcggaggagaagctgcaggagaaagctcgaaaatggcagcaattg
caggccaagcgctatgcagaaaagcggaagtttgggtttgtggatgcccagaaggaagac
atgcccccagaacatgtcaggaagatcattcgagaccatggagacatgaccaacaggaag
ttccgccatgacaaaagggtttacttgggtgccctaaagtacatgccccacgcagtcctc
aaactcctggagaacatgcctatgccttgggagcagattcgggatgtgcctgtgctgtac
cacatcactggagccatttccttcgtcaatgagattccctgggtcattgaacctgtctac
atctcccagtgggggtcaatgtggattatgatgcgccgagaaaaaagagataggaggcat
ttcaagaggatgcgttttcccccttttgatgatgaggagccgcccttggactatgctgac
aacatcctagatgttgagccactggaggccattcagctagagctggaccctgaggaggac
gcccctgtgttggactggttctatgaccaccagccgttgagggacagcaggaagtatgta
aatggctccacttaccagcgctggcagttcacactacctatgatgtcgactctctaccgc
ctggctaatcagctcctgacagacttggtggatgacaactacttctacctgtttgatttg
aaggccttctttacgtccaaggcactcaatatggccattcctggaggccccaaatttgaa
cctcttgttcgagacatcaacctacaggatgaagactggaatgaattcaatgatattaac
aagattatcatccggcagcctatccgcactgagtacaagattgcttttccttacttgtac
aacaatcttccacaccatgtccacctcacctggtaccatactcccaatgttgtattcatc
aaaactgaggatcctgacttgccagctttctactttgaccctttgatcaacccaatctcc
cataggcactcagtcaagagccaggaaccattgccggatgatgatgaggaatttgagctc
ccggagtttgtggagcccttcctgaaggacacacccctctatacagacaatacagccaat
ggcattgccctgctctgggccccgcggcccttcaacctacgctctggtcgcacccgtcgg
gccctggacataccccttgtcaagaactggtatcgggagcattgtcctgccgggcagcct
gtgaaagtgagggtctcctaccagaagctgcttaagtactatgtgctgaatgccctgaag
catcggccccctaaggctcaaaagaagaggtatttgttccgctccttcaaagccaccaaa
ttctttcagtccacaaagctggactgggtggaggttgggctccaggtttgccgccagggc
tacaacatgctcaaccttctcattcaccgcaaaaacctcaactacctgcacctggactac
aacttcaacctcaagcctgtgaaaacgctcaccaccaaggaaagaaagaaatctcgtttt
gggaatgctttccacctgtgtcgggaagttctgcgtttgactaagctggtggtggatagt
cacgtgcagtatcggctgggcaatgtggatgccttccagctggcagatggattgcagtat
atatttgcccatgttgggcagttgacgggcatgtatcgatacaaatacaagctgatgcga
cagattcgcatgtgcaaggacctgaagcatctcatctattatcgtttcaacacgggccct
gtagggaagggtcctggctgtggcttctgggctgccggttggcgagtctggctctttttc
atgcgtggcattacccctttattagagcgatggcttggcaacctcctggcccggcagttt
gaaggtcgacactcaaagggggtggcaaagacagtaacaaagcagcgagtggagtcacat
tttgaccttgagctgcgggcagctgtgatgcatgatattctggacatgatgcctgagggg
atcaagcagaacaaggcccggacaatcctgcagcacctcagtgaagcctggcgctgctgg
aaagccaacattccctggaaggtccctgggctgccgacgcccatagagaatatgatcctt
cgatacgtgaaggccaaggctgactggtggaccaacactgcccactacaaccgagaacgg
atccgccgaggggccactgtggacaagactgtttgtaaaaagaatctgggccgcctcacc
cggctctatctgaaggcagaacaggagcggcagcacaactacctgaaggacgggccttac
atcacagcggaggaagcagtggcagtatataccaccacagtgcattggttggaaagccgc
aggttttcacccatcccattccccccactctcctataagcatgacaccaagttgctcatc
ttggcattggagcggctcaaggaagcttatagtgtgaagtctcggttgaaccagtctcag
agggaggagctaggtctgatcgagcaggcctacgataacccccacgaggcgctgtcccgc
atcaagcgtcacctcctcacacagagagccttcaaagaggtgggcattgagttcatggat
ctgtatagccacctcgttccagtatatgatgttgagcccctggagaagataactgatgct
tacctggaccagtacctgtggtatgaagccgacaagcgccgcctgttcccaccctggatt
aagcctgcagacacagaaccacctccgctgcttgtttacaagtggtgtcaaggcatcaat
aacctgcaggacgtgtgggagacgagtgaaggcgagtgcaatgtcatgctggaatcccgc
tttgagaagatgtatgagaagatcgacttgactctgctcaacaggctgctgcgcctcatc
gtggaccacaacatagccgactacatgacagccaagaacaacgtcgtcatcaactataag
gacatgaaccatacgaattcatatgggatcatcagaggcctgcagtttgcctcattcatc
gtgcagtattatggcctggtgatggatttgcttgtattgggattgcaccgggccagtgag
atggctgggccccctcagatgccaaatgactttctcagtttccaggacatagccactgag
gctgcccaccccatccgtctcttctgcagatacattgatcgcatccatatttttttcagg
ttcacagcagatgaggctcgggacctgattcaacgttacctgacagagcaccctgacccc
aataatgaaaacatcgttggctataataacaagaagtgctggccccgagatgcccgcatg
cgcctcatgaaacatgatgttaacttaggccgggcggtattctgggacatcaagaaccgc
ttgccacggtcagtgactacagttcagtgggagaacagcttcgtgtctgtgtacagtaag
gacaaccccaacctgctgttcaacatgtgtggcttcgagtgccgcatcctgcctaagtgc
cgcaccagctatgaggagttcacccacaaggacggggtctggaacctgcagaatgaggtt
actaaggagcgcacagctcagtgtttcctgcgtgtggacgatgagtcaatgcagcgcttc
cacaaccgcgtgcgtcagattctcatggcctctgggtccaccaccttcaccaagattgtg
aataagtggaatacagctctcattggccttatgacatactttcgggaggctgtggtgaac
acccaagagctcttggacttactggtgaagtgtgagaacaaaatccagacacgtatcaag
attggactcaactccaagatgccaagtcggttccccccggttgtgttctacacccctaag
gagttgggtggactcggcatgctctcaatgggccatgtgctcatcccccaatccgacctc
aggtggtccaaacagacagatgtaggtatcacacactttcgttcaggaatgagccatgaa
gaagaccagctcattcccaacttgtaccgctacatacagccatgggagagcgagttcatt
gattctcagcgggtctgggctgagtacgcactcaagaggcaagaggccattgctcagaac
agacgcctgactttagaagacctagaagattcatgggatcgtggcattcctcgaatcaat
accctcttccagaaggaccggcacacactggcttatgataagggctggcgtgtcagaact
gactttaagcagtatcaggttttgaagcagaatccgttctggtggacacaccagcggcat
gatgggaagctctggaacctgaacaactaccgtacagacatgatccaggccctgggcggt
gtggaaggcattctggaacacacactctttaagggcacttacttccctacctgggagggg
cttttctgggagaaggccagtggctttgaggaatctatgaagtggaagaagctaactaat
gctcagcgatcaggactgaaccagattcccaatcgtagattcaccctctggtggtccccg
accattaatcgagccaatgtatatgtaggctttcaggtgcagctagacctgacgggtatc
ttcatgcacggcaagatccccacgctgaagatctctctcatccagatcttccgagctcac
ttgtggcagaagatccatgagagcattgttatggacttatgtcaggtgtttgaccaggaa
cttgatgcactggaaattgagacagtacaaaaggagacaatccatccccgaaagtcatat
aagatgaactcttcctgtgcagatatcctgctctttgcctcctataagtggaatgtctcc
cggccctcattgctggctgactccaaggatgtgatggacagcaccaccacccagaaatac
tggattgacatccagttgcgctggggggactatgattcccacgacattgagcgctacgcc
cgggccaagttcctggactacaccaccgacaacatgagtatctacccttcgcccacaggt
gtactcatcgccattgacctggcctataacttgcacagtgcctatggaaactggttccca
ggcagcaagcctctcatacaacaggccatggccaagatcatgaaggcaaaccctgccctg
tatgtgttacgtgaacggatccgcaaggggctacagctctattcatctgaacccactgag
ccttatttgtcttctcagaactatggtgagctcttctccaaccagattatctggtttgtg
gatgacaccaacgtctacagagtgactattcacaagacctttgaagggaacttgacaacc
aagcccatcaacggagccatcttcatcttcaacccacgcacagggcagctgttcctcaag
ataatccacacgtccgtgtgggcgggacagaagcgtttggggcagttggctaagtggaag
acagctgaggaggtggccgccctgatccgatctctgcctgtggaggagcagcccaagcag
atcattgtcaccaggaagggcatgctggacccactggaggtgcacttactggacttcccc
aatattgtcatcaaaggatcggagctccaactccctttccaggcgtgtctcaaggtggaa
aaattcggggatctcatccttaaagccactgagccccagatggttctcttcaacctctat
gacgactggctcaagactatttcatcttacacggccttctcccgtctcatcctgattctg
cgtgccctacatgtgaacaacgatcgggcaaaagtgatcctgaagccagacaagactact
attacagaaccacaccacatctggcccactctgactgacgaagaatggatcaaggtcgag
gtgcagctcaaggatctgatcttggctgactacggcaagaaaaacaatgtgaacgtggca
tcactgacacaatcagaaattcgagacatcatcctgggtatggagatctcggcaccgtca
cagcagcggcagcagatcgctgagatcgagaagcagaccaaggaacaatcgcagctgacg
gcaacacagactcgcactgtcaacaagcatggcgatgagatcatcacctccaccaccagc
aactatgagacccagactttctcatccaagactgagtggagggtcagggccatctctgct
gccaacctgcacctaaggaccaatcacatctatgtttcatctgacgacatcaaggagact
ggctacacctacatccttcccaagaatgtgcttaagaagttcatctgcatatctgacctt
cgggcccaaattgcaggatacctatatggggtgagcccaccagataacccccaggtgaag
gagatccgctgcattgtgatggtgccgcagtggggcactcaccagaccgtgcacctgcct
ggccagctgccccagcatgagtacctcaaggagatggaacccttaggttggatccacact
cagcccaatgagtccccgcagttatcaccccaggatgtcaccacccatgccaagatcatg
gctgacaacccatcttgggatggcgagaagaccattatcatcacatgcagcttcacgcca
ggctcctgtacactgacggcctacaagctgacccccagtggctacgaatggggccgccag
aacacagacaagggcaacaaccccaagggctacctgccttcacactatgagagggtgcag
atgctgctgtcggaccgtttccttggcttcttcatggtccctgcccagtcctcgtggaac
tacaacttcatgggtgttcggcatgaccccaacatgaaatatgagctacagctggcgaac
cccaaagagttctaccacgaggtgcacaggccctctcacttcctcaactttgctctcctg
caggagggggaggtttactctgcggatcgggaggacctgtatgcctga

DBGET integrated database retrieval system