KEGG   Homo sapiens (human): 10772
Entry
10772             CDS       T01001                                 
Symbol
SRSF10, FUSIP1, FUSIP2, NSSR, PPP1R149, SFRS13, SFRS13A, SRp38, SRrp40, TASR, TASR1, TASR2
Name
(RefSeq) serine and arginine rich splicing factor 10
  KO
K12900  serine/arginine-rich splicing factor 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10772 (SRSF10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10772 (SRSF10)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10772 (SRSF10)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10772 (SRSF10)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10772 (SRSF10)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2
Other DBs
NCBI-GeneID: 10772
NCBI-ProteinID: NP_473357
OMIM: 605221
HGNC: 16713
Ensembl: ENSG00000188529
Pharos: O75494(Tbio)
UniProt: O75494 A0A0S2Z504
LinkDB
Position
1:complement(23964347..23980327)
AA seq 262 aa
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFED
VRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSR
SRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSR
SRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSR
SQSRSRSKSRSRSWTSPKSSGH
NT seq 789 nt   +upstreamnt  +downstreamnt
atgtcccgctacctgcgtccccccaacacgtctctgttcgtcaggaacgtggccgacgac
accaggtctgaagacttgcggcgtgaatttggtcgttatggtcctatagttgatgtgtat
gttccacttgatttctacactcgccgtccaagaggatttgcttatgttcaatttgaggat
gttcgtgatgctgaagacgctttacataatttggacagaaagtggatttgtggacggcag
attgaaatacagtttgcccagggggatcgaaagacaccaaatcagatgaaagccaaggaa
gggaggaatgtgtacagttcttcacgctatgatgattatgacagatacagacgttctaga
agccgaagttatgaaaggaggagatcaagaagtcggtcttttgattacaactatagaaga
tcgtatagtcctagaaacagtagaccgactggaagaccacggcgtagcagaagccattcc
gacaatgatagattcaaacaccgaaatcgatctttttcaagatctaaatccaattcaaga
tcacggtccaagtcccagcccaagaaagaaatgaaggctaaatcacgttctaggtctgca
tctcacaccaaaactagaggcacctctaaaacagattccaaaacacattataagtctggc
tcaagatatgaaaaggaatcaaggaaaaaagaaccacctagatccaaatctcagtcaaga
tcacagtctaggtctaggtcaaaatctagatcaaggtcttggactagtcctaagtccagt
ggccactga

KEGG   Homo sapiens (human): 10929
Entry
10929             CDS       T01001                                 
Symbol
SRSF8, DSM-1, SFRS2B, SRP46
Name
(RefSeq) serine and arginine rich splicing factor 8
  KO
K12891  serine/arginine-rich splicing factor 2/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10929 (SRSF8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10929 (SRSF8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10929 (SRSF8)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    10929 (SRSF8)
SSDB
Motif
Pfam: RRM_1 RRM_occluded
Other DBs
NCBI-GeneID: 10929
NCBI-ProteinID: NP_115285
OMIM: 603269
HGNC: 16988
Ensembl: ENSG00000263465
Pharos: Q9BRL6(Tdark)
UniProt: Q9BRL6 A0A024R3A8
Structure
LinkDB
Position
11:95066877..95071225
AA seq 282 aa
MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFV
RFHDRRDAQDAEAAMDGAELDGRELRVQVARYGRRDLPRSRQGEPRGRSRGGGYGRRSRS
YGRRSRSPRRRHRSRSRGPSCSRSRSRSRYRGSRYSRSPYSRSPYSRSRYSRSPYSRSRY
RESRYGGSHYSSSGYSNSRYSRYHSSRSHSKSGSSTSSRSASTSKSSSARRSKSSSVSRS
RSRSRSSSMTRSPPRVSKRKSKSRSRSKRPPKSPEEEGQMSS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagctgcggccgcccccctcccgacgtggacggcatgatcaccctcaaggtggacaac
ctgacctaccgcacctctcccgacagcttgaggcgcgtgttcgagaagtacgggcgcgtg
ggcgacgtgtacatcccgcgggagccccacaccaaggcgccccggggcttcgctttcgtc
cgctttcacgaccggcgcgacgcccaagacgccgaggccgccatggacggggcggagctg
gacggacgcgagctgcgggtgcaggtggcgcgctatggccgccgggacctgccccgcagc
cgccagggagagccacgcggcaggtccagaggcggcggctacggacggcggagccgcagc
tacgggcggcggagccgcagccccaggcggcgacaccgcagccgatcccggggtcccagc
tgctccaggtcccgcagccgatctcgctataggggttctcgctatagccggtctccctac
agccgatctccttacagccggtcgcgctacagccgctctccctacagcagatctcgctac
agggaatctcgctacggcggatctcactacagctcatctggttacagtaactctcgctac
agccgatatcacagcagccggtctcactcgaagtctgggtcctccactagctctcgctct
gcatcaacctccaaatcgagctctgcgcgacgatccaagtcctcctcggtctccaggtct
cgctcgcggtccaggtcttcatctatgaccaggagtcctccccgggtatccaagaggaaa
tccaagtcaaggtcgcgatccaagaggccccccaagtctcctgaagaggaaggacagatg
tcctcttaa

KEGG   Homo sapiens (human): 29896
Entry
29896             CDS       T01001                                 
Symbol
TRA2A, AWMS1, HSU53209
Name
(RefSeq) transformer 2 alpha homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29896 (TRA2A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    29896 (TRA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    29896 (TRA2A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    29896 (TRA2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29896 (TRA2A)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    29896 (TRA2A)
SSDB
Motif
Pfam: RRM_1 Apt1
Other DBs
NCBI-GeneID: 29896
NCBI-ProteinID: NP_037425
OMIM: 602718
HGNC: 16645
Ensembl: ENSG00000164548
Pharos: Q13595(Tbio)
UniProt: Q13595 Q549U1
LinkDB
Position
7:complement(23504780..23531981)
AA seq 282 aa
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt   +upstreamnt  +downstreamnt
atgagtgatgtggaggaaaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcggagagcaggtcaggatctcgtagtccatca
agggtttccaaacactctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
aggagacattctcatagacgttacactcgatccagatcccactctcactctcataggaga
cgatctcgaagtagatcatatacaccagaataccggcggcgaaggagccgaagccattct
ccaatgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgc
cttggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttct
cgatatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcga
ggatttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggca
aatggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcg
cacacaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtgga
ggaggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgataga
ggatatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatca
ccttctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaaga
cgctattga

KEGG   Homo sapiens (human): 6426
Entry
6426              CDS       T01001                                 
Symbol
SRSF1, ASF, SF2, SF2p33, SFRS1, SRp30a
Name
(RefSeq) serine and arginine rich splicing factor 1
  KO
K12890  serine/arginine-rich splicing factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04657  IL-17 signaling pathway
hsa05168  Herpes simplex virus 1 infection
Network
nt06168  Herpes simplex virus 1 (HSV-1)
nt06170  Influenza A virus (IAV)
  Element
N00586  Nuclear export of mRNA
N00587  HSV ICP27 to Nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6426 (SRSF1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6426 (SRSF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6426 (SRSF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6426 (SRSF1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6426 (SRSF1)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Nup35_RRM_2 RRM_7 DDE_Tnp_1 CoV_nucleocap
Other DBs
NCBI-GeneID: 6426
NCBI-ProteinID: NP_008855
OMIM: 600812
HGNC: 10780
Ensembl: ENSG00000136450 ENSG00000266086
Pharos: Q07955(Tbio)
UniProt: Q07955
Structure
LinkDB
Position
17:complement(57989038..58007246)
AA seq 248 aa
MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVE
FEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSE
NRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKF
RSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPR
HSRSRSRT
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcgggaggtggtgtgattcgtggccccgcagggaacaacgattgccgcatctacgtg
ggtaacttacctccagacatccgaaccaaggacattgaggacgtgttctacaaatacggc
gctatccgcgacatcgacctcaagaatcgccgcgggggaccgcccttcgccttcgttgag
ttcgaggacccgcgagacgcggaagacgcggtgtatggtcgcgacggctatgattacgat
gggtaccgtctgcgggtggagtttcctcgaagcggccgtggaacaggccgaggcggcggc
gggggtggaggtggcggagctccccgaggtcgctatggccccccatccaggcggtctgaa
aacagagtggttgtctctggactgcctccaagtggaagttggcaggatttaaaggatcac
atgcgtgaagcaggtgatgtatgttatgctgatgtttaccgagatggcactggtgtcgtg
gagtttgtacggaaagaagatatgacctatgcagttcgaaaactggataacactaagttt
agatctcatgagggagaaactgcctacatccgggttaaagttgatgggcccagaagtcca
agttatggaagatctcgatctcgaagccgtagtcgtagcagaagccgtagcagaagcaac
agcaggagtcgcagttactccccaaggagaagcagaggatcaccacgctattctccccgt
catagcagatctcgctctcgtacataa

KEGG   Homo sapiens (human): 6427
Entry
6427              CDS       T01001                                 
Symbol
SRSF2, PR264, SC-35, SC35, SFRS2, SFRS2A, SRp30b
Name
(RefSeq) serine and arginine rich splicing factor 2
  KO
K12891  serine/arginine-rich splicing factor 2/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Disease
H01481  Myelodysplastic syndrome
H02410  Myelodysplastic/myeloproliferative neoplasms
H02411  Chronic myelomonocytic leukemia
H02412  Atypical chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6427 (SRSF2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6427 (SRSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6427 (SRSF2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6427 (SRSF2)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_occluded RRM_5
Other DBs
NCBI-GeneID: 6427
NCBI-ProteinID: NP_001182356
OMIM: 600813
HGNC: 10783
Ensembl: ENSG00000161547
Pharos: Q01130(Tbio)
UniProt: Q01130 A0A024R8U5 Q53FN0
Structure
LinkDB
Position
17:complement(76734115..76737411)
AA seq 221 aa
MSYGRPPPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFV
RFHDKRDAEDAMDAMDGAVLDGRELRVQMARYGRPPDSHHSRRGPPPRRYGGGGYGRRSR
SPRRRRRSRSRSRSRSRSRSRSRYSRSKSRSRTRSRSRSTSKSRSARRSKSKSSSVSRSR
SRSRSRSRSRSPPPVSKRESKSRSRSKSPPKSPEEEGAVSS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgagctacggccgcccccctcccgatgtggagggtatgacctccctcaaggtggacaac
ctgacctaccgcacctcgcccgacacgctgaggcgcgtcttcgagaagtacgggcgcgtc
ggcgacgtgtacatcccgcgggaccgctacaccaaggagtcccgcggcttcgccttcgtt
cgctttcacgacaagcgcgacgctgaggacgctatggatgccatggacggggccgtgctg
gacggccgcgagctgcgggtgcaaatggcgcgctacggccgccccccggactcacaccac
agccgccggggaccgccaccccgcaggtacgggggcggtggctacggacgccggagccgc
agccctaggcggcgtcgccgcagccgatcccggagtcggagtcgttccaggtctcgcagc
cgatctcgctacagccgctcgaagtctcggtcccgcactcgttctcgatctcggtcgacc
tccaagtccagatccgcacgaaggtccaagtccaagtcctcgtcggtctccagatctcgt
tcgcggtccaggtcccggtctcggtccaggagtcctcccccagtgtccaagagggaatcc
aaatccaggtcgcgatcgaagagtccccccaagtctcctgaagaggaaggagcggtgtcc
tcttaa

KEGG   Homo sapiens (human): 6428
Entry
6428              CDS       T01001                                 
Symbol
SRSF3, SFRS3, SRp20
Name
(RefSeq) serine and arginine rich splicing factor 3
  KO
K12892  serine/arginine-rich splicing factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6428 (SRSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6428 (SRSF3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6428 (SRSF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6428 (SRSF3)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6428 (SRSF3)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 6428
NCBI-ProteinID: NP_003008
OMIM: 603364
HGNC: 10785
Ensembl: ENSG00000112081
Pharos: P84103(Tbio)
UniProt: P84103 B2R6F3
Structure
LinkDB
Position
6:36594362..36605600
AA seq 164 aa
MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAA
DAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRS
FSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK
NT seq 495 nt   +upstreamnt  +downstreamnt
atgcatcgtgattcctgtccattggactgtaaggtttatgtaggcaatcttggaaacaat
ggcaacaagacggaattggaacgggcttttggctactatggaccactccgaagtgtgtgg
gttgctagaaacccacccggctttgcttttgttgaatttgaagatccccgagatgcagct
gatgcagtccgagagctagatggaagaacactatgtggctgccgtgtaagagtggaactg
tcgaatggtgaaaaaagaagtagaaatcgtggcccacctccctcttggggtcgtcgccct
cgagatgattatcgtaggaggagtcctccacctcgtcgcagatctccaagaaggagaagc
ttctctcgcagccggagcaggtccctttctagagataggagaagagagagatcgctgtct
cgggagagaaatcacaagccgtcccgatccttctctaggtctcgtagtcgatctaggtca
aatgaaaggaaatag

KEGG   Homo sapiens (human): 6429
Entry
6429              CDS       T01001                                 
Symbol
SRSF4, SFRS4, SRP75
Name
(RefSeq) serine and arginine rich splicing factor 4
  KO
K12893  serine/arginine-rich splicing factor 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6429 (SRSF4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6429 (SRSF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6429 (SRSF4)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6429 (SRSF4)
SSDB
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Other DBs
NCBI-GeneID: 6429
NCBI-ProteinID: NP_005617
OMIM: 601940
HGNC: 10786
Ensembl: ENSG00000116350
Pharos: Q08170(Tbio)
UniProt: Q08170
LinkDB
Position
1:complement(29147743..29181900)
AA seq 494 aa
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS
RSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKS
RSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRS
REESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKS
ESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSAS
RSPSRSRSRSHSRS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgccgcgggtgtacatcggccgcctgagctaccaggcccgggagcgcgatgtggagcgc
ttctttaagggctacgggaagatcctggaggtggatctgaagaacggatatggttttgtg
gagtttgatgatctgcgtgatgcagatgatgctgtttatgaactgaatggcaaagacctt
tgtggtgagcgagtaattgttgagcatgcccgcggcccacggcgagatggcagttacggt
tctggacgcagtggatatggttatagaagaagtggccgagataaatatggccctcctact
cgcacagagtacagacttattgtggagaatttgtcaagtcggtgcagctggcaagaccta
aaggattatatgcgtcaggcaggagaagtgacttatgcagatgctcacaagggacgcaaa
aatgaaggggtgattgaatttgtatcttattctgatatgaaaagagctttggaaaagttg
gatggaactgaagtcaatgggagaaaaatcagattagttgaagacaagccaggttccaga
cgacgccggtcctactccagaagccggagtcattcaaggtctcgctctcgaagcagacat
tcccgtaagagcagaagccgaagtggcagcagcaaaagcagtcattctaagagtagatct
cggtccaggtcgggctcccgctcccggagcaagagccggagccggagccagagtcggagc
cggagcaagaaagagaaaagcaggagccccagcaaggaaaagagccgcagccgcagccat
agcgctggcaagagccgcagcaagagcaaagaccaagctgaagagaagatccaaaacaat
gacaatgtcgggaaacccaagagccggagtcctagcaggcataaaagtaagagcaaaagt
cggagcaggagtcaggagaggagagtggaggaggagaagcgagggagtgtgagcaggggc
aggagccaggagaagagcctccgccagagtcggagccggagcaggagcaaagggggcagc
aggagccggagcaggagccgcagcaagagcaaggacaagaggaagggcaggaagagaagc
agagaggagagccgcagtcgcagtcgcagccgcagcaagagtgagaggagcagaaagcga
ggcagcaagcgagacagcaaggcgggcagcagcaagaagaagaagaaggaagacactgac
cgctcccagtccagatctccatcccgctccgtgtcaaaggagcgggaacatgccaagtct
gaatccagccagagggaaggtcgaggagagagtgagaatgctggcaccaatcaggagacc
cggtccaggtcgagatccaattccaaatcgaaaccaaaccttccatcagaatcacgctcc
agatcaaagtcagcttcaaaaacccgatctcggtccaagtctagatccaggtctgcttcc
agatcgccctcccgatctagatctaggtcccactcaaggtcctaa

KEGG   Homo sapiens (human): 6430
Entry
6430              CDS       T01001                                 
Symbol
SRSF5, HRS, SFRS5, SRP40
Name
(RefSeq) serine and arginine rich splicing factor 5
  KO
K12893  serine/arginine-rich splicing factor 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6430 (SRSF5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6430 (SRSF5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6430 (SRSF5)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6430 (SRSF5)
SSDB
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2 RRM_5
Other DBs
NCBI-GeneID: 6430
NCBI-ProteinID: NP_001034554
OMIM: 600914
HGNC: 10787
Ensembl: ENSG00000100650
Pharos: Q13243(Tbio)
UniProt: Q13243 A0A024R6D8
LinkDB
Position
14:69767142..69772005
AA seq 272 aa
MSGCRVFIGRLNPAAREKDVERFFKGYGRIRDIDLKRGFGFVEFEDPRDADDAVYELDGK
ELCSERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVS
WQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRKIKLIEGS
KRHSRSRSRSRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSPVPEKSQ
KRGSSSRSKSPASVDRQRSRSRSRSRSVDSGN
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagtggctgtcgggtattcatcgggagactaaatccagcggccagggagaaggacgtg
gaaagattcttcaagggatatggacggataagagatattgatctgaaaagaggctttggt
tttgtggaatttgaggatccaagggatgcagatgatgctgtgtatgagcttgatggaaaa
gaactctgtagtgaaagggttactattgaacatgctagggctcggtcacgaggtggaaga
ggtagaggacgatactctgaccgttttagtagtcgcagacctcgaaatgatagacgaaat
gctccacctgtaagaacagaaaatcgtcttatagttgagaatttatcctcaagagtcagc
tggcaggatctcaaagatttcatgagacaagctggggaagtaacgtttgcggatgcacac
cgacctaaattaaatgaaggggtggttgagtttgcctcttatggtgacttaaagaatgct
attgaaaaactttctggaaaggaaataaatgggagaaaaataaaattaattgaaggcagc
aaaaggcacagtaggtcaagaagcaggtctcgatcccggaccagaagttcctctaggtct
cgtagccgatcccgttcccgtagtcgcaaatcttacagccggtcaagaagcaggagcagg
agccggagccggagcaagtcccgttctgttagtaggtctcccgtgcctgagaagagccag
aaacgtggttcttcaagtagatctaagtctccagcatctgtggatcgccagaggtcccgg
tcccgatcaaggtccagatcagttgacagtggcaattaa

KEGG   Homo sapiens (human): 6431
Entry
6431              CDS       T01001                                 
Symbol
SRSF6, B52, HEL-S-91, SFRS6, SRP55
Name
(RefSeq) serine and arginine rich splicing factor 6
  KO
K12893  serine/arginine-rich splicing factor 4/5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6431 (SRSF6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6431 (SRSF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6431 (SRSF6)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6431 (SRSF6)
SSDB
Motif
Pfam: RRM_1 RRM_3 RRM_5 RRM_occluded Nup35_RRM_2
Other DBs
NCBI-GeneID: 6431
NCBI-ProteinID: NP_006266
OMIM: 601944
HGNC: 10788
Ensembl: ENSG00000124193
Pharos: Q13247(Tbio)
UniProt: Q13247
LinkDB
Position
20:43457896..43464243
AA seq 344 aa
MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKEL
CGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSR
CSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIE
DKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKG
RKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSR
SNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgccgcgcgtctacataggacgcctgagctacaacgtccgggagaaggacatccagcgc
tttttcagtggctatggccgcctcctcgaagtagacctcaaaaatgggtacggcttcgtg
gagttcgaggactcccgcgacgccgacgacgccgtttacgagctgaacggcaaggagctc
tgcggcgagcgcgtgatcgtagagcacgcccggggcccgcgtcgcgatcgcgacggctac
agctacggaagccgcagtggtggaggtggatacagcagtcggagaacatctggcagagac
aaatacggaccacctgttcgtacagaatacaggcttattgtagaaaatctttctagtcgg
tgcagttggcaagatttaaaggattttatgcgacaagcaggtgaagtaacctatgcggat
gcccacaaggaacgaacaaatgagggtgtaattgagtttcgctcctactctgacatgaag
cgtgctttggacaaactggatggcacagaaataaatggcagaaatattaggcttattgaa
gataagccacgcacaagccataggcgatcttactctggaagcagatccaggtctcgatct
agaagacggtcacgaagtaggagtcgcaggagcagccgcagtagatctcgaagtatctca
aaaagtcgctcccgttccaggtcgcggagcaaaggtcgatcacgttctcgatcaaaaggc
aggaaatctagatcaaagagcaaatctaagcccaagtctgatcggggctcccattcacat
tctcgaagcagatctaaggatgagtatgagaaatctcgaagcaggtctcggtcccgatcc
cctaaagaaaatggaaagggtgatataaagtcaaaatccagatcaaggagccagtcccgt
tccaattcgccgctacctgttccaccctcaaaggcccgttctgtgtcccctccaccaaaa
agagctacttcaagatcccgttctagatctcgctcaaagtcaagatcaaggtccaggtcg
agttccagagattaa

KEGG   Homo sapiens (human): 6432
Entry
6432              CDS       T01001                                 
Symbol
SRSF7, 9G8, AAG3, SFRS7
Name
(RefSeq) serine and arginine rich splicing factor 7
  KO
K12896  serine/arginine-rich splicing factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6432 (SRSF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    6432 (SRSF7)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6432 (SRSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6432 (SRSF7)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6432 (SRSF7)
SSDB
Motif
Pfam: RRM_1 zf-CCHC RRM_5 zf-CCHC_3
Other DBs
NCBI-GeneID: 6432
NCBI-ProteinID: NP_001026854
OMIM: 600572
HGNC: 10789
Ensembl: ENSG00000115875
Pharos: Q16629(Tbio)
UniProt: Q16629
Structure
LinkDB
Position
2:complement(38743599..38751494)
AA seq 238 aa
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcgcgttacgggcggtacggaggagaaaccaaggtgtatgttggtaacctgggaact
ggcgctggcaaaggagagttagaaagggctttcagttattatggtcctttaagaactgta
tggattgcgagaaatcctccaggatttgcctttgtggaattcgaagatcctagagatgca
gaagatgcagtacgaggactggatggaaaggtgatttgtggctcccgagtgagggttgaa
ctatcgacaggcatgcctcggagatcacgttttgatagaccacctgcccgacgtcccttt
gatccaaatgatagatgctatgagtgtggcgaaaagggacattatgcttatgattgtcat
cgttacagccggcgaagaagaagcaggtcacggtctagatcacattctcgatccagagga
aggcgatactctcgctcacgcagcaggagcaggggacgaaggtcaaggtcagcatctcct
cgacgatcaagatctatctctcttcgtagatcaagatcagcttcactcagaagatctagg
tctggttctataaaaggatcgaggtatttccaatccccgtcgaggtcaagatcaagatcc
aggtctatttcacgaccaagaagcagccgatcaaagtccagatctccatctccaaaaaga
agtcgttccccatcaggaagtcctcgcagaagtgcaagtcctgaaagaatggactga

KEGG   Homo sapiens (human): 6434
Entry
6434              CDS       T01001                                 
Symbol
TRA2B, Htra2-beta, PPP1R156, SFRS10, SRFS10, TRA2-BETA, TRAN2B
Name
(RefSeq) transformer 2 beta homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04936  Alcoholic liver disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6434 (TRA2B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    6434 (TRA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6434 (TRA2B)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6434 (TRA2B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6434 (TRA2B)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    6434 (TRA2B)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_3 Apt1
Other DBs
NCBI-GeneID: 6434
NCBI-ProteinID: NP_004584
OMIM: 602719
HGNC: 10781
Ensembl: ENSG00000136527
Pharos: P62995(Tbio)
UniProt: P62995
Structure
LinkDB
Position
3:complement(185914558..185938014)
AA seq 288 aa
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPARSRSKEDSRRSRSKSRSRSESRSRS
RRSSRRHYTRSRSRSRSHRRSRSRSYSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCCL
GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERAN
GMELDGRRIRVDFSITKRPHTPTPGIYMGRPTYGSSRRRDYYDRGYDRGYDDRDYYSRSY
RGGGGGGGGWRAAQDRDQIYRRRSPSPYYSRGGYRSRSRSRSYSPRRY
NT seq 867 nt   +upstreamnt  +downstreamnt
atgagcgacagcggcgagcagaactacggcgagcgggaatcccgttctgcttccagaagt
ggaagtgctcacggatcggggaaatctgcaaggcatacccctgcaaggtctcgctccaag
gaagattccaggcgttccagatcaaagtccaggtcccgatctgaatctaggtctagatcc
agaagaagctcccgaaggcattatacccggtcacggtctcgctcccgctcccatagacga
tcacgtagcaggtcttacagtcgagattatcgtagacggcacagccacagccattctccc
atgtctactcgcaggcgtcatgttgggaatcgggcaaatcctgatcctaactgttgtctt
ggagtatttgggctgagcttgtacaccacagaaagagatctaagagaagtgttctctaaa
tatggtcccattgccgatgtgtctattgtatatgaccagcagtctaggcgttcaagagga
tttgcctttgtatattttgaaaatgtagatgatgccaaggaagctaaagaacgtgccaat
ggaatggagcttgatgggcgtaggatcagagttgatttctctataacaaaaagaccacat
acgccaacaccaggaatttacatggggagacctacctatggcagctctcgccgtcgggat
tactatgacagaggatatgatcggggctatgatgatcgggactactatagcagatcatac
agaggaggaggtggaggaggaggaggatggagagctgcccaagacagggatcagatttat
agaaggcggtcaccttctccttactatagtcgtggaggatacagatcacgttccagatct
cgatcatactcacctcgtcgctattaa

KEGG   Homo sapiens (human): 8683
Entry
8683              CDS       T01001                                 
Symbol
SRSF9, SFRS9, SRp30c
Name
(RefSeq) serine and arginine rich splicing factor 9
  KO
K21123  serine/arginine-rich splicing factor 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    8683 (SRSF9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8683 (SRSF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8683 (SRSF9)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    8683 (SRSF9)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM_2 RRM_3 RRM_7 RRM_occluded
Other DBs
NCBI-GeneID: 8683
NCBI-ProteinID: NP_003760
OMIM: 601943
HGNC: 10791
Ensembl: ENSG00000111786
Pharos: Q13242(Tbio)
UniProt: Q13242
LinkDB
Position
12:complement(120461672..120469748)
AA seq 221 aa
MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFE
DPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPP
SGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYI
RVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtcgggctgggcggacgagcgcggcggcgagggcgacgggcgcatctacgtggggaac
cttccgaccgacgtgcgcgagaaggacttggaggacctgttctacaagtacggccgcatc
cgcgagatcgagctcaagaaccggcacggcctcgtgcccttcgccttcgtgcgcttcgag
gacccccgagatgcagaggatgctatttatggaagaaatggttatgattatggccagtgt
cggcttcgtgtggagttccccaggacttatggaggtcggggtgggtggccccgtggtggg
aggaatgggcctcctacaagaagatctgatttccgagttcttgtttcaggacttcctccg
tcaggcagctggcaggacctgaaggatcacatgcgagaagctggggatgtctgttatgct
gatgtgcagaaggatggagtggggatggtcgagtatctcagaaaagaagacatggaatat
gccctgcgtaaactggatgacaccaaattccgctctcatgagggtgaaacttcctacatc
cgagtttatcctgagagaagcaccagctatggctactcacggtctcggtctgggtcaagg
ggccgtgactctccataccaaagcaggggttccccacactacttctctcctttcaggccc
tactga

DBGET integrated database retrieval system