KEGG   Homo sapiens (human): 10841
Entry
10841             CDS       T01001                                 
Symbol
FTCD, LCHC1
Name
(RefSeq) formimidoyltransferase cyclodeaminase
  KO
K13990  glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase [EC:2.1.2.5 4.3.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00340  Histidine metabolism
hsa00670  One carbon pool by folate
hsa01100  Metabolic pathways
Module
hsa_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Disease
H01262  Formiminotransferase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    10841 (FTCD)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    10841 (FTCD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10841 (FTCD)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10841 (FTCD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     10841 (FTCD)
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.4  formimidoyltetrahydrofolate cyclodeaminase
     10841 (FTCD)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    10841 (FTCD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10841 (FTCD)
SSDB
Motif
Pfam: FTCD_N FTCD_C FTCD
Other DBs
NCBI-GeneID: 10841
NCBI-ProteinID: NP_006648
OMIM: 606806
HGNC: 3974
Ensembl: ENSG00000160282
Vega: OTTHUMG00000090488
Pharos: O95954(Tbio)
UniProt: O95954
LinkDB
Position
21:complement(46136262..46155579)
AA seq 541 aa
MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
GALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELD
VPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARK
FLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLD
FEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRI
RLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVA
AAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYL
EAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDL
QVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQ
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtcccagctggtggaatgcgtccccaacttttcggaggggaagaaccaggaggtgatc
gacgccatctctggagccatcacacagaccccgggctgcgtgctgctggatgtggacgca
ggcccttccaccaaccgcaccgtgtacaccttcgtggggccgccggagtgcgtggtggag
ggggccctcaacgctgcccgggtagcttcccgacttatcgacatgagcaggcaccaagga
gagcacccccgcatgggggccctagacgtctgccccttcatccccgtgaggggcgtcagc
gtggatgagtgtgtgctctgcgcccaggcctttggccagaggctggcagaggagctggac
gtgccagtttacctgtacggcgaggcagccaggatggacagtcgccggaccctgccggcc
atccgggccggggagtacgaggccctccctaagaagctccagcaggccgactgggcgccc
gactttggtcccagctcctttgtccccagttggggggccacggccacgggggcgaggaag
ttcctcattgcttttaacatcaacctgctcggcacaaaggagcaagcccaccgcatcgcg
ctcaacctgcgggagcagggccgcgggaaggaccagccaggacgtctgaagaaagttcag
ggcattggctggtacctggatgagaagaacctggctcaggtgtccaccaatcttctggac
tttgaggtcacggcactgcacacggtctacgaggagacctgccgagaagcacaggagctg
agcctcccagtggtgggctcacagctggtgggcctggtgcccctgaaggctctgctggat
gcggccgccttctactgcgagaaggagaacctcttcatcctggaggaggagcagcggatc
aggctggtggtgagccggctgggcctggactccctgtgccccttcagccctaaggagcgg
atcatcgagtacctggtccctgagcgcgggcctgagcgaggcctgggcagcaagtccctg
cgcgccttcgtgggggaggtgggtgcccgctctgcggcccccgggggcggctcggtggcg
gcggccgctgcggccatgggtgcggcgctgggctccatggtgggcctcatgacctacggg
cggcgccaattccagtccctggacacgacgatgcggcgcctgatcccgcccttccgcgag
gcttcggccaagctaaccacgctggtggatgccgacgccgaggccttcaccgcctacctg
gaagcaatgaggctccccaagaacacacctgaggaaaaggacaggcgcacggcggcccta
caggagggtctgaggcgggcagtctctgtgccgctgacgctggcggagacggtggcctcg
ctgtggccggccctgcaggaactggcccggtgtgggaacctggcctgccggtcagacctc
caggtggcggccaaagccctggagatgggcgtgtttggcgcatatttcaacgtgctcatc
aacctgagggacatcacagacgaggcatttaaggaccagatccaccatcgtgtttccagc
ctcctgcaggaagccaagacccaggctgcactggtgctggactgcttggagacccggcag
gagtga

DBGET integrated database retrieval system