KEGG   Homo sapiens (human): 11317
Entry
11317             CDS       T01001                                 
Symbol
RBPJL, RBPL, RBPSUHL, SUHL
Name
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region like
  KO
K06053  recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05017  Spinocerebellar ataxia
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
nt06465  Prion disease
nt06511  NOTCH signaling
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
N01480  Notch-HES7 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    11317 (RBPJL)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    11317 (RBPJL)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    11317 (RBPJL)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    11317 (RBPJL)
   05165 Human papillomavirus infection
    11317 (RBPJL)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    11317 (RBPJL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    11317 (RBPJL)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    11317 (RBPJL)
SSDB
Motif
Pfam: BTD LAG1-DNAbind TIG_SUH
Other DBs
NCBI-GeneID: 11317
NCBI-ProteinID: NP_055091
OMIM: 616104
HGNC: 13761
Ensembl: ENSG00000124232
Pharos: Q9UBG7(Tbio)
UniProt: Q9UBG7
LinkDB
Position
20:45306840..45317824
AA seq 517 aa
MDPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTTILRGGVRRC
LQQQCEQTVRILHAKVAQKSYGNEKRFFCPPPCVYLSGPGWRVKPGQDQAHQAGETGPTV
CGYMGLDSASGSATETQKLNFEQQPDSREFGCAKTLYISDADKRKHFRLVLRLVLRGGRE
LGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVA
SARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGITLPPMIIRKVAKQCAL
LDVDEPISQLHKCAFQFPGSPPGGGGTYLCLATEKVVQFQASPCPKEANRALLNDSSCWT
IIGTESVEFSFSTSLACTLEPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDV
EAETMYRSPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYS
VRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggaccccgcaggggcagcagacccctcagtgcctcccaatcctttgactcacctgagc
ctgcaggacagatcagagatgcagctgcagagcgaagccgacaggcggagcctcccgggc
acttggaccaggtcatccccagagcacaccaccattctgaggggaggcgtgcgcaggtgc
ctgcagcaacagtgtgaacagactgtgcggatcctgcatgccaaggtggcccagaaatca
tacggaaatgagaagcggttcttctgccccccgccctgtgtctacctctcggggcctggc
tggagggtgaagccagggcaggatcaagctcaccaggcgggggaaacggggcccacggtc
tgcggttacatgggactggacagcgcgtccggcagcgccactgagacgcagaagctgaat
ttcgagcagcagccggactccagggaattcggctgcgccaagaccctgtacatctcagat
gcagacaagaggaagcactttcggctggtgctgcggctggtgctgcgcgggggccgggag
ctgggtaccttccacagccgccttatcaaggtcatctcgaagccctcgcagaagaagcag
tcgctgaaaaacaccgatctgtgcatatcctccggctcaaaggtctccctcttcaaccgc
ctgcgctctcagacggtctccacacgctacctctctgtggaggatggggcctttgtggcc
agtgcacgacagtgggctgccttcacgctccacctggctgatgggcactctgcccaagga
gacttcccaccgcgagagggctacgttcgctatggctccctggtgcagctcgtctgcacg
gtcaccggcatcacactacctcccatgatcatccgtaaagtagcaaaacagtgtgcgctc
cttgatgtggatgagcccatctcccagctgcacaagtgtgcattccagtttccaggcagt
cccccaggagggggtggcacctacttatgccttgccacagagaaggtggtgcaatttcag
gcctctccctgccccaaggaggcgaacagggctctgcttaacgacagctcttgctggacc
atcatcggcaccgagtcggtggaattttccttcagcaccagcctggcgtgtaccctggag
ccggtcactccggtgcctctcatcagcaccctagagctgagcggcgggggcgacgtggcc
acgctggagctccacggagagaacttccacgcggggctcaaggtgtggtttggggacgtg
gaggcagaaaccatgtacaggagcccgcggtccctggtgtgcgtggtgccggacgtggcg
gccttctgcagcgactggcgctggctgcgcgctcccatcacaatccccatgagcctggtg
cgcgccgacgggctcttctaccctagtgccttctccttcacctacaccccggaatacagc
gtgcggccgggtcaccccggcgtccccgagcccgccaccgacgccgacgcgctcctggag
agcatccatcaggagttcacgcgcaccaacttccacctcttcatccagacttag

DBGET integrated database retrieval system