KEGG   Homo sapiens (human): 1312
Entry
1312              CDS       T01001                                 
Symbol
COMT, HEL-S-98n
Name
(RefSeq) catechol-O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04728  Dopaminergic synapse
Disease
H01450  Obsessive-compulsive disorder
Drug target
Entacapone: D00781<JP/US>
Flopropione: D01259<JP>
Nitecapone: D03241
Opicapone: D10825<JP/US>
Phloroglucinol (DG00050): D00152 D08369
Tolcapone: D00786<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1312 (COMT)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    1312 (COMT)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    1312 (COMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1312 (COMT)
   04147 Exosome [BR:hsa04147]
    1312 (COMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     1312 (COMT)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1312 (COMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   1312 (COMT)
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24 Methyltransf_15 CmcI PCMT Methyltransf_31
Other DBs
NCBI-GeneID: 1312
NCBI-ProteinID: NP_000745
OMIM: 116790
HGNC: 2228
Ensembl: ENSG00000093010
Pharos: P21964(Tclin)
UniProt: P21964 A0A140VJG8
Structure
LinkDB
Position
22:19941772..19969975
AA seq 271 aa
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL
NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG
YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY
DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE
CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
NT seq 816 nt   +upstreamnt  +downstreamnt
atgccggaggccccgcctctgctgttggcagctgtgttgctgggcctggtgctgctggtg
gtgctgctgctgcttctgaggcactggggctggggcctgtgccttatcggctggaacgag
ttcatcctgcagcccatccacaacctgctcatgggtgacaccaaggagcagcgcatcctg
aaccacgtgctgcagcatgcggagcccgggaacgcacagagcgtgctggaggccattgac
acctactgcgagcagaaggagtgggccatgaacgtgggcgacaagaaaggcaagatcgtg
gacgccgtgattcaggagcaccagccctccgtgctgctggagctgggggcctactgtggc
tactcagctgtgcgcatggcccgcctgctgtcaccaggggcgaggctcatcaccatcgag
atcaaccccgactgtgccgccatcacccagcggatggtggatttcgctggcgtgaaggac
aaggtcacccttgtggttggagcgtcccaggacatcatcccccagctgaagaagaagtat
gatgtggacacactggacatggtcttcctcgaccactggaaggaccggtacctgccggac
acgcttctcttggaggaatgtggcctgctgcggaaggggacagtgctactggctgacaac
gtgatctgcccaggtgcgccagacttcctagcacacgtgcgcgggagcagctgctttgag
tgcacacactaccaatcgttcctggaatacagggaggtggtggacggcctggagaaggcc
atctacaagggcccaggcagcgaagcagggccctga

KEGG   Homo sapiens (human): 220074
Entry
220074            CDS       T01001                                 
Symbol
LRTOMT, CFAP111, DFNB63, LRRC51, LRRC51-TOMT, TOMT
Name
(RefSeq) leucine rich transmembrane and O-methyltransferase domain containing
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
hsa04728  Dopaminergic synapse
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    220074 (LRTOMT)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    220074 (LRTOMT)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    220074 (LRTOMT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    220074 (LRTOMT)
   04147 Exosome [BR:hsa04147]
    220074 (LRTOMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     220074 (LRTOMT)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   220074 (LRTOMT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   220074 (LRTOMT)
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24 PCMT Methyltransf_31
Other DBs
NCBI-GeneID: 220074
NCBI-ProteinID: NP_001138780
OMIM: 612414
HGNC: 25033
Ensembl: ENSG00000284922
Pharos: Q8WZ04(Tbio)
UniProt: Q8WZ04
LinkDB
Position
11:72080850..72110782
AA seq 291 aa
MGTPWRKRKGIAGPGLPDLSCALVLQPRAQVGTMSPAIALAFLPLVVTLLVRYRHYFRLL
VRTVLLRSLRDCLSGLRIEERAFSYVLTHALPGDPGHILTTLDHWSSRCEYLSHMGPVKG
QILMRLVEEKAPACVLELGTYCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAG
FDEHMVELIVGSSEDVIPCLRTQYQLSRADLVLLAHRPRCYLRDLQLLEAHALLPAGATV
LADHVLFPGAPRFLQYAKSCGRYRCRLHHTGLPDFPAIKDGIAQLTYAGPG
NT seq 876 nt   +upstreamnt  +downstreamnt
atgggaaccccatggaggaagagaaagggtatagcaggccctggactccccgacctgtcc
tgtgctctggtcctccagcccagggcccaggtagggaccatgtcccctgccattgcattg
gccttcctgccactggtggtaacattgctggtgcggtaccggcactacttccgattgctg
gtgcgcacggtcttgctgcgaagcctccgagactgcctgtcagggctgcggatcgaggag
cgggccttcagctacgtgctcacccatgccctgcccggtgaccctggtcacatcctcacc
accctggaccactggagcagccgctgcgagtacttgagccacatggggcctgtcaaaggt
cagatcctgatgcggctggtggaggagaaggcccctgcttgtgtgctggaattgggaacc
tactgtggatactctaccctgcttattgcccgagccctgccccctgggggtcgccttctt
actgtggagcgggacccacgcacggcagcagtggctgaaaaactcatccgcctggccggc
tttgatgagcacatggtggagctcatcgtgggcagctcagaggacgtgatcccgtgccta
cgcacccagtatcagctgagtcgggcagacctggtgctcctggcacaccggccacgatgt
tacctgagggacctgcagctgctggaggcccatgccctactgccagcaggtgccaccgtg
ctggctgaccatgtgctcttccctggtgcaccccgcttcttgcagtatgctaagagctgt
ggccgctaccgctgccgcctccaccacactggccttccagacttccctgccatcaaggat
ggaatagctcagctcacctatgctggaccaggctga

DBGET integrated database retrieval system