KEGG   Homo sapiens (human): 1557Help
Entry
1557              CDS       T01001                                 

Gene name
CYP2C19, CPCJ, CYP2C, CYPIIC17, CYPIIC19, P450C2C, P450IIC19
Definition
(RefSeq) cytochrome P450 family 2 subfamily C member 19
  KO
K17721  cytochrome P450 family 2 subfamily C polypeptide 19 [EC:1.14.14.51 1.14.14.52 1.14.14.53 1.14.14.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
hsa05204  Chemical carcinogenesis
Disease
H01171  Poor drug metabolism (PM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    1557 (CYP2C19)
   00591 Linoleic acid metabolism
    1557 (CYP2C19)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    1557 (CYP2C19)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    1557 (CYP2C19)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    1557 (CYP2C19)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.51  (S)-limonene 6-monooxygenase
     1557 (CYP2C19)
    1.14.14.52  (S)-limonene 7-monooxygenase
     1557 (CYP2C19)
    1.14.14.53  (R)-limonene 6-monooxygenase
     1557 (CYP2C19)
    1.14.14.-  
     1557 (CYP2C19)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1557 (CYP2C19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 1557
NCBI-ProteinID: NP_000760
OMIM: 124020
HGNC: 2621
Ensembl: ENSG00000165841
Vega: OTTHUMG00000018799
Pharos: P33261(Tchem)
UniProt: P33261
LinkDB All DBs
Structure
PDB: 

Position
10q23.33
AA seq 490 aa AA seqDB search
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKI
YGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFM
ESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYID
LIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFK
KSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgtggtccttgtgctctgtctctcatgtttgcttctcctttcaatctgg
agacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagatagatattaaggatgtcagcaaatccttaaccaatctctcaaaaatc
tatggccctgtgttcactctgtattttggcctggaacgcatggtggtgctgcatggatat
gaagtggtgaaggaagccctgattgatcttggagaggagttttctggaagaggccatttc
ccactggctgaaagagctaacagaggatttggaatcgttttcagcaatggaaagagatgg
aaggagatccggcgtttctccctcatgacgctgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcttcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccagaaacgtttcgattataaagatcagcaatttcttaacttgatggaaaaa
ttgaatgaaaacatcaggattgtaagcaccccctggatccagatatgcaataattttccc
actatcattgattatttcccgggaacccataacaaattacttaaaaaccttgcttttatg
gaaagtgatattttggagaaagtaaaagaacaccaagaatcgatggacatcaacaaccct
cgggactttattgattgcttcctgatcaaaatggagaaggaaaagcaaaaccaacagtct
gaattcactattgaaaacttggtaatcactgcagctgacttacttggagctgggacagag
acaacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtcattggcagaaaccggagcccctgcatgcag
gacaggggccacatgccctacacagatgctgtggtgcacgaggtccagagatacatcgac
ctcatccccaccagcctgccccatgcagtgacctgtgacgttaaattcagaaactacctc
attcccaagggcacaaccatattaacttccctcacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcgtcactttctggatgaaggtggaaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagagggcctg
gcccgcatggagctgtttttattcctgaccttcattttacagaactttaacctgaaatct
ctgattgacccaaaggaccttgacacaactcctgttgtcaatggatttgcttctgtcccg
cccttctatcagctgtgcttcattcctgtctga

DBGET integrated database retrieval system