KEGG   Homo sapiens (human): 1793
Entry
1793              CDS       T01001                                 
Symbol
DOCK1, DOCK180, ced5
Name
(RefSeq) dedicator of cytokinesis 1
  KO
K13708  dedicator of cytokinesis protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N00951  ITGA/B-RHOG-RAC signaling pathway
N00952  Shigella IpgB1 to ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01090  IGG-FCGR-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1793 (DOCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1793 (DOCK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    1793 (DOCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    1793 (DOCK1)
   05135 Yersinia infection
    1793 (DOCK1)
   05100 Bacterial invasion of epithelial cells
    1793 (DOCK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1793 (DOCK1)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    1793 (DOCK1)
SSDB
Motif
Pfam: DOCK_N DOCK-C2 DHR-2_Lobe_A DHR-2_Lobe_C DHR-2_Lobe_B SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 1793
NCBI-ProteinID: NP_001371
OMIM: 601403
HGNC: 2987
Ensembl: ENSG00000150760
Pharos: Q14185(Tbio)
UniProt: Q14185 B2RUU3 A0A2X0U2H5
Structure
LinkDB
Position
10:126905428..127452516
AA seq 1865 aa
MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIF
PASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRH
MIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTS
TISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDA
EVLMSLYDPVESKFISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQ
IVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDF
LQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAVARKTGFPEIIM
PGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKS
VIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYD
GTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKGHSATGKSMQSLGSCTISKD
SFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLMKVDGGEVVKFLQDTLDALFN
IMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLK
NYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFRSIN
DMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYC
LIEIVHSDLFTQHDCREILLPMMTDQLKYHLERQEDLEACCQLLSHILEVLYRKDVGPTQ
RHVQIIMEKLLRTVNRTVISMGRDSELIGNFVACMTAILRQMEDYHYAHLIKTFGKMRTD
VVDFLMETFIMFKNLIGKNVYPFDWVIMNMVQNKVFLRAINQYADMLNKKFLDQANFELQ
LWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKYGDMRRQIGFEIRDMWYNLGQHKIKF
IPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGR
GDEQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCT
VNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQ
RDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKK
QAQFYENIVKVIRPKPDYFAVGYYGQGFPTFLRGKVFIYRGKEYERREDFEARLLTQFPN
AEKMKTTSPPGDDIKNSPGQYIQCFTVKPKLDLPPKFHRPVSEQIVSFYRVNEVQRFEYS
RPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQLT
NDKINSMVQQHLDDPSLPINPLSMLLNGIVDPAVMGGFANYEKAFFTDRYLQEHPEAHEK
IEKLKDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSS
LDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSR
SQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQR
PKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPP
PLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQASVD
SGIVQ
NT seq 5598 nt   +upstreamnt  +downstreamnt
atgacgcgctgggtgcccaccaagcgcgaggagaagtacggcgtggctttttataactat
gatgccagaggagcggatgaactttctttacagatcggagacactgtgcacatcttagaa
acatatgaagggtggtaccgaggttacacgttacgaaaaaagtctaagaagggtatattt
cctgcttcatatattcatcttaaagaagcgatagttgaaggaaaagggcaacatgaaaca
gtcatcccgggtgacctccccctcatccaggaagtcaccacgacactccgagagtggtcc
accatctggaggcagctctacgtgcaagataacagggagatgtttcgaagtgtgcggcac
atgatctatgaccttattgaatggcgatcacaaattctttctggaactctgcctcaggat
gaactcaaagaactgaagaagaaggtcacagccaaaattgattatggaaacagaattcta
gatttggacctggtggttagagatgaagatgggaatattttggatccagaattaactagc
acgattagtctcttcagagctcatgaaatagcttctaaacaagtggaggaaaggttacaa
gaggaaaaatctcaaaagcagaacatagatattaacagacaagccaagtttgctgcaacc
ccttctctggccttgtttgtgaacctcaaaaatgtggtttgtaaaataggagaagatgct
gaagtcctcatgtctctatatgaccctgtggagtccaaattcatcagtgagaactacctg
gttcgctggtccagttcaggattacctaaagacatagacagattacataatttgcgagcc
gtgtttactgacctcggaagcaaagacctgaaaagggagaaaatcagttttgtctgtcag
attgttcgcgtgggtcgcatggagctgagggacaacaacaccaggaaactgacctcgggg
ttgcggcgaccttttggagtggctgtgatggatgtaacagatataataaatggaaaagta
gatgatgaagataagcagcatttcattccctttcagccggtggcaggggagaatgacttc
cttcagactgttataaacaaagtcatcgctgccaaagaagtcaaccacaaggggcagggt
ttgtgggtaacattgaaattacttcctggagatatccatcagatccgaaaagagtttccg
catttagtggacaggaccacagctgtggctcgaaaaacagggtttccggagataatcatg
cctggtgatgttcgaaatgatatctatgtaacattagttcaaggagattttgataaagga
agcaaaacaacagcgaagaacgtggaggtcacggtgtctgtgtacgatgaggatgggaaa
cgattagagcatgtgattttcccgggtgctggtgatgaagcgatttcagagtacaaatct
gtgatttactaccaagtaaagcagccacgctggtttgagactgttaaggtggccattccc
atcgaggacgttaaccgcagtcaccttcggtttaccttccgccacaggtcatcacaggac
tctaaggataaatctgagaaaatatttgcactagcatttgtcaagctgatgagatacgat
ggtaccaccctgcgagacggagagcacgatcttatcgtctataaggccgaagcaaagaag
ctggaagatgctgccacgtacttgagtctgccctccacgaaggcagagttggaagaaaag
ggccactcggccaccggcaagagcatgcagagccttgggagctgcaccattagcaaggac
tccttccagatctccacgctcgtgtgctccaccaaactgactcagaacgtggaccttctg
gggctcttgaaatggcgctccaacaccagcctgctgcagcagaacttgaggcagctgatg
aaagtcgatggtggtgaagtagtgaagtttcttcaggacacgttggatgccctcttcaac
atcatgatggagaactcagagagtgagacttttgacacgttagtctttgatgctctggta
tttatcattggactgattgctgatagaaaatttcagcattttaatcctgttttggaaact
tacattaagaaacactttagtgcaacgttagcctacacgaagttgacaaaagtgttgaag
aactacgtggacggtgctgagaagccgggagtaaatgagcagctgtacaaagccatgaaa
gcgctagaatccatcttcaagttcatcgtgcgctccaggatcctgttcaatcaactgtat
gaaaacaagggagaggctgacttcgtggaatctttgctgcagctcttcaggtccatcaat
gacatgatgagcagcatgtcagaccagaccgtccgggtgaagggggcagcactgaaatac
ttaccaacgatcgtcaacgatgtgaaattggtgtttgatcccaaagagctcagcaaaatg
tttactgaattcatcctcaatgttcccatgggcttgctgaccatccagaaactctactgc
ttgatcgaaatcgtccacagtgacctcttcacacagcatgactgcagagagatcctgctt
cccatgatgaccgatcagctcaagtaccatctggagagacaggaggacctggaggcctgc
tgtcagctgctcagccacatcctggaggtgctgtacaggaaggacgtggggccaacccag
aggcacgtccagattatcatggagaaacttctccggaccgtgaaccgaaccgtcatttcc
atgggacgagattctgaactcattggaaacttcgtggcttgcatgacagctattttacga
caaatggaagattaccattatgcccacttgatcaagacttttgggaaaatgaggactgat
gtggtagatttcctaatggaaacattcatcatgtttaagaacctcattggaaagaacgtt
taccccttcgactgggtgatcatgaacatggtgcaaaataaagtcttcctgcgagcaatt
aatcagtatgcagatatgctgaacaaaaaatttctggatcaagccaactttgagctacag
ctgtggaacaactactttcacctggctgttgctttccttactcaagagtccctgcaactg
gagaatttttcaagtgccaagagagccaaaatccttaacaagtacggagatatgaggaga
cagattggctttgaaatcagagacatgtggtacaaccttggtcaacacaagataaagttc
attccagaaatggtgggcccaatattagaaatgacattaattcccgagacggagctgcgc
aaagccaccatccccatcttctttgatatgatgcagtgtgaattccattcgacccgaagc
ttccaaatgtttgaaaatgagatcatcaccaagctggatcatgaagtcgaaggaggcaga
ggagacgaacagtacaaagtgttatttgataaaatccttctggaacactgcaggaagcac
aaatacctcgccaaaacaggagaaacttttgtaaaactcgttgtgcgcttaatggaaagg
cttttggattatagaaccatcatgcacgacgagaacaaagaaaaccgcatgagctgcacc
gtcaatgtgctgaatttctacaaagaaattgaaagagaagaaatgtatataaggtatttg
tacaagctctgtgacctgcacaaggagtgtgataactacaccgaagcggcttacaccttg
cttctccatgcaaagcttcttaagtggtcggaggatgtgtgtgtggcccacctcacccag
cgggacgggtaccaggccaccacgcagggacagctgaaggagcagctctaccaggaaatc
atccactacttcgacaaaggcaagatgtgggaggaggccattgccttgggcaaggagcta
gccgagcagtatgagaacgaaatgtttgattatgagcaactcagcgaattgctgaaaaaa
caggctcagttttatgaaaacatcgtcaaagtgatcaggcccaagcctgactattttgct
gttggctactacggacaagggttccccacattcctgcggggaaaagttttcatttaccga
gggaaagagtatgagcgccgggaagattttgaggctcggctcttaactcagtttccaaac
gccgagaaaatgaagacaacatctccaccaggcgacgatattaaaaactctcctggccag
tatattcagtgcttcacagtgaagcccaaactcgatctgcctcctaagtttcacaggcca
gtgtcagagcagattgtaagtttttacagggtgaacgaggtccagcgatttgaatattct
cggccaatccggaagggagagaaaaacccagacaatgaatttgcgaatatgtggatcgag
agaaccatatatacaactgcatataaattacctggaattttaaggtggtttgaggtcaag
tctgttttcatggtggaaatcagccccctggagaatgccattgagaccatgcagctgacg
aacgacaagatcaacagcatggtgcagcagcacctggatgaccccagcctgcccatcaac
ccgctctccatgctcctgaacggcatcgtggacccagctgtcatggggggcttcgcaaac
tacgaaaaggccttctttacagaccggtacctgcaggagcaccctgaggcccatgaaaag
atcgagaagctcaaggacctgattgcttggcagattccttttctggccgaagggatcaga
atccatggagacaaagtcacggaggcactgaggccgttccacgagaggatggaggcctgt
ttcaaacagctgaaggaaaaggtggagaaagagtacggcgtccgaatcatgccctcaagt
ctggatgatagaagaggcagccgcccccggtccatggtgcggtccttcacgatgccttcc
tcatcccgccctctgtctgtggcctctgtctcttccctctcatcggacagcaccccttcc
agaccaggctccgacgggtttgccctggagcctctcctgccaaagaaaatgcactccagg
tcccaggacaagctggacaaggatgacctggagaaggagaagaaggacaagaagaaggaa
aaaaggaacagcaaacatcaagagatatttgagaaagaatttaaacccaccgacatttcc
ctgcagcagtctgaggctgtgatcctttcggaaacgataagtcccctgcggccccagaga
ccgaagagccaggtgatgaacgtcattggaagcgaaaggcgcttctcggtgtccccctcg
tcaccgtcctcccagcaaacaccccctccagttacaccaagggccaagctcagcttcagc
atgcagtcgagcttggagctgaacggcatgacgggggcggacgtggccgatgtcccaccc
cctctgcctctcaaaggcagcgtggcagattacgggaatttgatggaaaaccaggacttg
ctgggctcgccaacacctccacctccccctccacaccagaggcatctgccacctccactg
cccagcaaaactccgcctcctccccctccaaagacaactcgcaagcaggcatcggtggac
tccgggatcgtgcagtga

KEGG   Homo sapiens (human): 9844
Entry
9844              CDS       T01001                                 
Symbol
ELMO1, CED-12, CED12, ELMO-1
Name
(RefSeq) engulfment and cell motility 1
  KO
K12366  engulfment and cell motility protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N00951  ITGA/B-RHOG-RAC signaling pathway
N00952  Shigella IpgB1 to ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01132  Salmonella SopE/E2 to RhoG signaling pathway
N01133  Salmonella SopB to RhoG signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    9844 (ELMO1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    9844 (ELMO1)
   05131 Shigellosis
    9844 (ELMO1)
   05135 Yersinia infection
    9844 (ELMO1)
   05100 Bacterial invasion of epithelial cells
    9844 (ELMO1)
SSDB
Motif
Pfam: ELMO_ARM ELMO_CED12 PH_12 FERM_N Imm42
Other DBs
NCBI-GeneID: 9844
NCBI-ProteinID: NP_001193409
OMIM: 606420
HGNC: 16286
Ensembl: ENSG00000155849
Pharos: Q92556(Tbio)
UniProt: Q92556 A4D1X5
Structure
LinkDB
Position
7:complement(36852906..37449326)
AA seq 727 aa
MPPPADIVKVAIEWPGAYPKLMEIDQKKPLSAIIKEVCDGWSLANHEYFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEF
INLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASFVNKSAIDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGSDQEIQ
TYTIAVINALFLKAPDERRQEMANILAQKQLRSIILTHVIRAQRAINNEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAESEPNNSSGSMEKRKSMYTRDYKKLG
FINHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIEL
TKMLCEILKVGELPSETCNDFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKV
MQVVKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKI
QPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVP
HDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKH
EYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNY
DFVYDCN
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgccgccacccgcggacatcgtcaaggtggccatagaatggccgggcgcctaccccaaa
ctcatggaaattgatcagaaaaaaccactgtctgcaataataaaggaagtctgtgatggg
tggtctcttgccaaccatgaatattttgcactccagcatgccgatagttcaaacttctat
atcacagaaaagaaccgcaatgagataaaaaatggcactatccttcgattaaccacatct
ccagctcagaacgcccagcagctccatgaacgaatccagtcctcgagtatggatgccaag
ctggaagccctgaaggacttggccagcctctcccgggatgtcacgtttgcccaggagttt
ataaacctggacggtatctctctcctcacgcagatggtggagagcggcactgagcgatac
cagaaattgcagaagatcatgaagccttgctttggagacatgctgtccttcaccctgacg
gccttcgttgagctgatggaccatggcatagtgtcctgggatacattttcggtggcgttc
attaagaagatagcaagttttgtgaacaagtcagccatagacatctcgatcctgcagcgg
tccttggccattttggagtcgatggtgctcaatagccatgacctctaccagaaagtggcg
caggagatcaccatcggccagctcattccacacctgcaagggtcagatcaagaaatccaa
acctatactattgcagtgattaatgcgcttttcctgaaggctcctgatgagaggaggcag
gagatggcgaatattttggctcagaagcaactgcgttccatcattttaacacatgtcatc
cgagcccagcgggccatcaacaatgagatggcgcaccagctgtatgttctacaagtgctc
acctttaacctcctggaagacaggatgatgaccaaaatggacccccaggaccaggctcag
agggacatcatatttgaacttcgaagaattgcttttgatgctgagtctgaacctaacaac
agcagtggcagcatggagaaacgcaagtccatgtacacgcgagattataagaagcttggg
ttcattaatcatgtcaaccctgccatggacttcacgcagactccacctgggatgttggct
ctggacaacatgctgtactttgccaagcaccaccaagatgcctacatccggattgtgctt
gagaacagtagtcgagaagacaagcatgaatgtccctttggccgcagtagtatagagctg
accaagatgctatgtgagatcttgaaagtgggcgagttgcctagtgagacctgcaacgac
ttccacccgatgttcttcacccacgacagatcctttgaggagtttttctgcatctgtatc
cagctcctgaacaagacatggaaggaaatgagggcaacttctgaagacttcaacaaggta
atgcaggtggtgaaggagcaggttatgagagcacttacaaccaagcctagctccctggac
cagttcaagagcaaactgcagaacctgagctacactgagatcctgaaaatccgccagtcc
gagaggatgaaccaggaagatttccagtcccgcccgattttggaactaaaggagaagatt
cagccagaaatcttagagctgatcaaacagcaacgcctgaaccgccttgtggaagggacc
tgctttaggaaactcaatgcccggcggaggcaagacaagttttggtattgtcggctttcg
ccaaatcacaaagtcctgcattacggagacttagaagagagtcctcagggagaagtgccc
cacgattccttgcaggacaaactgccggtggcagatatcaaagccgtggtgacgggaaag
gactgccctcatatgaaagagaaaggtgcccttaaacaaaacaaggaggtgcttgaactc
gctttctccatcttgtatgactcaaactgccaactgaacttcatcgctcctgacaagcat
gagtactgtatctggacggatggactgaatgcgctactcgggaaggacatgatgagcgac
ctgacgcggaatgacctggacaccctgctcagcatggaaatcaagctccgcctcctggac
ctggaaaacatccagatccctgacgcacctccgccgattcccaaggagcccagcaactat
gacttcgtctatgactgtaactga

DBGET integrated database retrieval system