KEGG   Homo sapiens (human): 1965
Entry
1965              CDS       T01001                                 

Gene name
EIF2S1, EIF-2, EIF-2A, EIF-2alpha, EIF2, EIF2A
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04140  Autophagy - animal
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05417  Lipid and atherosclerosis
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N01009  PERK-ATF4 signaling pathway
N01010  Mutation-caused aberrant PSEN1 to PERK-ATF4 signaling pathway
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01149  Mutation-caused aberrant SOD1 to PERK-ATF4 signaling pathway
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1965 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1965 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    1965 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    1965 (EIF2S1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1965 (EIF2S1)
   05164 Influenza A
    1965 (EIF2S1)
   05162 Measles
    1965 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    1965 (EIF2S1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1965 (EIF2S1)
   05012 Parkinson disease
    1965 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    1965 (EIF2S1)
   05020 Prion disease
    1965 (EIF2S1)
   05022 Pathways of neurodegeneration - multiple diseases
    1965 (EIF2S1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    1965 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1965 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1965 (EIF2S1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    1965 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1 DUF4453
Other DBs
NCBI-GeneID: 1965
NCBI-ProteinID: NP_004085
OMIM: 603907
HGNC: 3265
Ensembl: ENSG00000134001
Vega: OTTHUMG00000029800
Pharos: P05198(Tbio)
UniProt: P05198 Q53XC0
LinkDB
Structure
PDB: 

Position
14q23.3
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTENMPIKINLIAPPRYVMTTT
TLERTEGLSVLSQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQMERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccgggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtcagatccattgctgaaatgggggcttatgtcagcttgctggaatacaac
aacattgaaggcatgattcttcttagtgaattatccagaaggcgtatccgttctatcaac
aaactcatccgaattggcaggaatgagtgtgtggttgtcattagggtggacaaagaaaaa
ggatatattgatttgtcaaaaagaagagtttctccagaggaagcaatcaaatgtgaagac
aaattcacaaaatccaaaactgtttatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcagctggaaagcctattccagaggactgcctgggtctttgatgac
aagtacaagagacctggatatggtgcctatgatgcatttaagcatgcagtctcagaccca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgcttgaccccacaggctgtcaaaattcgagcagatattgaagtggcttgttat
ggttatgaaggcattgatgctgtaaaagaagccctaagagcaggtttgaattgttctaca
gaaaacatgcccattaagattaatctaatagctcctcctcggtatgtaatgactacgaca
accctggagagaacagaaggcctttctgtcctcagtcaagctatggctgttatcaaagag
aagattgaggaaaagaggggtgtgttcaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcgaggcagatggagaggcttgaaagagaaaatgccgaagtg
gatggagatgatgatgcagaagaaatggaagccaaagctgaagattaa

DBGET integrated database retrieval system