KEGG   Homo sapiens (human): 2161
Entry
2161              CDS       T01001                                 
Symbol
F12, HAE3, HAEX, HAF
Name
(RefSeq) coagulation factor XII
  KO
K01328  coagulation factor XII (Hageman factor) [EC:3.4.21.38]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06514  Coagulation cascade
  Element
N01506  Intrinsic pathway of coagulation cascade, F12 activation
Disease
H00941  Factor XII deficiency
H01006  Hereditary angioedema
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2161 (F12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2161 (F12)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    2161 (F12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.38  coagulation factor XIIa
     2161 (F12)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2161 (F12)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   2161 (F12)
SSDB
Motif
Pfam: Trypsin Kringle fn2 EGF fn1 Trypsin_2 hEGF EGF_2 DUF1986
Other DBs
NCBI-GeneID: 2161
NCBI-ProteinID: NP_000496
OMIM: 610619
HGNC: 3530
Ensembl: ENSG00000131187
Pharos: P00748(Tbio)
CPD: C03379
UniProt: P00748 Q8IZZ5
Structure
LinkDB
Position
5:complement(177402141..177409564)
AA seq 615 aa
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgagggctctgctgctcctggggttcctgctggtgagcttggagtcaacactttcgatt
ccaccttgggaagcccccaaggagcataagtacaaagctgaagagcacacagtcgttctc
actgtcaccggggagccctgccacttccccttccagtaccaccggcagctgtaccacaaa
tgtacccacaagggccggccaggccctcagccctggtgtgctaccacccccaactttgat
caggaccagcgatggggatactgtttggagcccaagaaagtgaaagaccactgcagcaaa
cacagcccctgccagaaaggagggacctgtgtgaacatgccaagcggcccccactgtctc
tgtccacaacacctcactggaaaccactgccagaaagagaagtgctttgagcctcagctt
ctccggtttttccacaagaatgagatatggtatagaactgagcaagcagctgtggccaga
tgccagtgcaagggtcctgatgcccactgccagcggctggccagccaggcctgccgcacc
aacccgtgcctccatgggggtcgctgcctagaggtggagggccaccgcctgtgccactgc
ccggtgggctacaccggagccttctgcgacgtggacaccaaggcaagctgctatgatggc
cgcgggctcagctaccgcggcctggccaggaccacgctctcgggtgcgccctgtcagccg
tgggcctcggaggccacctaccggaacgtgactgccgagcaagcgcggaactggggactg
ggcggccacgccttctgccggaacccggacaacgacatccgcccgtggtgcttcgtgctg
aaccgcgaccggctgagctgggagtactgcgacctggcacagtgccagaccccaacccag
gcggcgcctccgaccccggtgtcccctaggcttcatgtcccactcatgcccgcgcagccg
gcaccgccgaagcctcagcccacgacccggaccccgcctcagtcccagaccccgggagcc
ttgccggcgaagcgggagcagccgccttccctgaccaggaacggcccactgagctgcggg
cagcggctccgcaagagtctgtcttcgatgacccgcgtcgttggcgggctggtggcgcta
cgcggggcgcacccctacatcgccgcgctgtactggggccacagtttctgcgccggcagc
ctcatcgccccctgctgggtgctgacggccgctcactgcctgcaggaccggcccgcaccc
gaggatctgacggtggtgctcggccaggaacgccgtaaccacagctgtgagccgtgccag
acgttggccgtgcgctcctaccgcttgcacgaggccttctcgcccgtcagctaccagcac
gacctggctctgttgcgccttcaggaggatgcggacggcagctgcgcgctcctgtcgcct
tacgttcagccggtgtgcctgccaagcggcgccgcgcgaccctccgagaccacgctctgc
caggtggccggctggggccaccagttcgagggggcggaggaatatgccagcttcctgcag
gaggcgcaggtaccgttcctctccctggagcgctgctcagccccggacgtgcacggatcc
tccatcctccccggcatgctctgcgcagggttcctcgagggcggcaccgatgcgtgccag
ggtgattccggaggcccgctggtgtgtgaggaccaagctgcagagcgccggctcaccctg
caaggcatcatcagctggggatcgggctgtggtgaccgcaacaagccaggcgtctacacc
gatgtggcctactacctggcctggatccgggagcacaccgtttcctga

DBGET integrated database retrieval system