KEGG   Homo sapiens (human): 23279
Entry
23279             CDS       T01001                                 
Symbol
NUP160, NPHS19
Name
(RefSeq) nucleoporin 160
  KO
K14303  nuclear pore complex protein Nup160
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    23279 (NUP160)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    23279 (NUP160)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23279 (NUP160)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23279 (NUP160)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     23279 (NUP160)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    23279 (NUP160)
SSDB
Motif
Pfam: Nup160
Other DBs
NCBI-GeneID: 23279
NCBI-ProteinID: NP_056046
OMIM: 607614
HGNC: 18017
Ensembl: ENSG00000030066
Vega: OTTHUMG00000166534
Pharos: Q12769(Tbio)
UniProt: Q12769
Structure
LinkDB
Position
11:complement(47778118..47848544)
AA seq 1402 aa
MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKL
FSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIIL
MLTNQTVHRLLLPHPSRMYRSELVVDSQMQSIFTDIGKVDFTDPCNYQLIPAVPGISPNS
TASTAWLSSDGEALFALPCASGGIFVLKLPPYDIPGMVSVVELKQSSVMQRLLTGWMPTA
IRGDQSPSDRPLSLAVHCVEHDAFIFALCQDHKLRMWSYKEQMCLMVADMLEYVPVKKDL
RLTAGTGHKLRLAYSPTMGLYLGIYMHAPKRGQFCIFQLVSTESNRYSLDHISSLFTSQE
TLIDFALTSTDIWALWHDAENQTVVKYINFEHNVAGQWNPVFMQPLPEEEIVIRDDQDPR
EMYLQSLFTPGQFTNEALCKALQIFCRGTERNLDLSWSELKKEVTLAVENELQGSVTEYE
FSQEEFRNLQQEFWCKFYACCLQYQEALSHPLALHLNPHTNMVCLLKKGYLSFLIPSSLV
DHLYLLPYENLLTEDETTISDDVDIARDVICLIKCLRLIEESVTVDMSVIMEMSCYNLQS
PEKAAEQILEDMITIDVENVMEDICSKLQEIRNPIHAIGLLIREMDYETEVEMEKGFNPA
QPLNIRMNLTQLYGSNTAGYIVCRGVHKIASTRFLICRDLLILQQLLMRLGDAVIWGTGQ
LFQAQQDLLHRTAPLLLSYYLIKWGSECLATDVPLDTLESNLQHLSVLELTDSGALMANR
FVSSPQTIVELFFQEVARKHIISHLFSQPKAPLSQTGLNWPEMITAITSYLLQLLWPSNP
GCLFLECLMGNCQYVQLQDYIQLLHPWCQVNVGSCRFMLGRCYLVTGEGQKALECFCQAA
SEVGKEEFLDRLIRSEDGEIVSTPRLQYYDKVLRLLDVIGLPELVIQLATSAITEAGDDW
KSQATLRTCIFKHHLDLGHNSQAYEALTQIPDSSRQLDCLRQLVVVLCERSQLQDLVEFP
YVNLHNEVVGIIESRARAVDLMTHNYYELLYAFHIYRHNYRKAGTVMFEYGMRLGREVRT
LRGLEKQGNCYLAALNCLRLIRPEYAWIVQPVSGAVYDRPGASPKRNHDGECTAAPTNRQ
IEILELEDLEKECSLARIRLTLAQHDPSAVAVAGSSSAEEMVTLLVQAGLFDTAISLCQT
FKLPLTPVFEGLAFKCIKLQFGGEAAQAEAWAWLAANQLSSVITTKESSATDEAWRLLST
YLERYKVQNNLYHHCVINKLLSHGVPLPNWLINSYKKVDAAELLRLYLNYDLLEEAVDLV
SEYVDAVLGKGHQYFGIEFPLSATAPMVWLPYSSIDQLLQALGENSANSHNIALSQKILD
KLEDYQQKVDKATRDLLYRRTL
NT seq 4209 nt   +upstreamnt  +downstreamnt
atggcggcggcgggagccctggaacggagcttcgtggagctaagcggagctgagcgcgaa
aggccgaggcactttcgggaattcacagtctgcagcattgggactgcaaatgccgtggct
ggcgccgtaaaatacagtgaaagcgcgggaggcttttactacgtggagagtggcaagttg
ttctccgtaaccagaaacaggttcattcattggaagacctctggagatacattggagctg
atggaggagtcactggacataaatctgttgaataatgccattcgcctaaaattccaaaat
tgcagtgttttacctggaggggtttatgtctctgagactcagaatcgtgtgataatcttg
atgttaaccaatcaaacagtgcacaggttacttttaccacacccctcccggatgtatagg
agtgagttggtagttgacagtcagatgcagtcaatattcactgacattggaaaagttgat
ttcacagatccttgcaactatcagttaattccagcagtacctggaatatctcctaattcc
accgcctctacagcctggctcagcagtgatggggaggccctgtttgccttaccatgtgct
tctgggggaatctttgttcttaagctacctccttatgacatacctggtatggtgtcagtc
gtggaactgaaacagagttcagtaatgcaacgattgcttacaggctggatgccaacagct
atcaggggtgaccagtcgccttcagatcgtcccctcagtcttgctgttcattgtgtggag
catgatgccttcatctttgctttgtgtcaggatcataaactacgaatgtggtcttacaag
gagcaaatgtgcctaatggtagctgacatgctggagtatgtccctgtgaagaaagacctt
cggcttactgctggaactggacacaaattacggcttgcttattcccccaccatgggactc
tacctggggatatacatgcatgcaccaaaacgaggacagttctgcattttccagttggtg
agcactgagagtaatcgctatagtctcgatcatatttcttcactgttcacttctcaggag
acactgattgactttgccttaacttccacggatatctgggccctgtggcatgatgctgag
aaccaaacagtagtgaaatacatcaactttgaacataatgttgcaggtcagtggaatcca
gtttttatgcagcctctgccagaggaagagattgtcatcagagatgatcaagaccccaga
gagatgtatctgcaaagtctttttacaccaggacaattcacaaatgaagctttatgtaag
gctttacagattttctgccgaggaactgagaggaatttggatctttcctggagtgaactg
aagaaagaagttactttagctgttgaaaatgagcttcaaggaagtgtaacagagtatgaa
ttctcccaggaggagtttcgaaatttacaacaagaattctggtgcaagttctatgcctgt
tgtcttcagtatcaagaagccctctctcaccctcttgccctacatttgaatccacacaca
aacatggtgtgcctgctgaaaaaagggtacctgtctttccttattccctcatccttagtg
gatcatttgtatctcctgccttatgagaaccttttgacagaagatgagacaaccatatct
gatgatgtggacatcgctcgggatgtcatatgtcttataaaatgcctccggctgattgaa
gagtcagtaactgtggatatgtcagttataatggaaatgagttgttataacctacagtct
ccggaaaaggctgcagagcagattctggaagatatgatcactattgatgtagaaaatgtg
atggaggatatttgtagtaaactgcaagagattaggaacccaatccatgcaattggacta
cttatacgggaaatggattatgaaacagaagtggaaatggaaaagggattcaatccagct
cagcctttgaatattcgaatgaatcttacccagctctatggtagtaacacagcagggtat
attgtgtgcagaggggtgcataaaatcgccagtactcgtttcctgatctgcagagatctt
ttgatcttacagcagctgttaatgaggcttggagatgctgtgatttggggaactggtcag
ctctttcaagctcagcaagacctactacatcgaacagctcccctactcttatcttattac
ctcattaaatggggaagtgagtgcttggcaactgatgttccacttgacacactggagtct
aatctccaacacttatcagtactggaattaacagactctggtgctttaatggcaaatagg
tttgtatctagtcctcagactattgtggagttattcttccaagaagttgcaagaaaacac
attatatctcacctcttctctcagccaaaggcacctctgagccaaactggattgaattgg
cctgaaatgattactgcaattaccagttatttattgcagcttttatggcctagcaatcct
ggttgtctctttctagaatgtttgatgggaaattgccaatatgtacaattgcaggattat
attcaactgctacatccctggtgtcaagtcaatgttggttcctgtcgatttatgctggga
aggtgttacctagttacaggagaaggacagaaggctctggaatgtttttgtcaggcagca
tctgaagtaggcaaagaggaattcttggatcgcttgattcgctcagaggatggggagatc
gtgtctacccccaggctgcagtattatgacaaggttttacgactactagatgtcattggt
ttgcctgaactggttattcagttggctacatcagccataactgaagcaggtgatgactgg
aaaagtcaggctactctaaggacatgtattttcaaacatcatttggatttgggtcacaat
agccaagcatatgaagccttaacccaaattcctgattccagcaggcaattagattgttta
cggcagttggtggtagttctttgtgaacgctcacagctacaggatcttgtagagtttccc
tatgtgaatctgcataatgaggttgtgggaataattgagtcacgtgctagagctgtggac
cttatgactcacaattactatgaacttctgtatgcctttcacatctatcgccacaattac
cgcaaggctggcacagtgatgtttgagtatggaatgcggcttggcagagaagttcgaact
ctccggggacttgagaaacaaggcaactgttatctggctgctctcaattgtttacgactt
attcgtccagaatatgcgtggattgtgcagccagtgtctggtgcagtgtatgatcgccct
ggagcatcccctaagaggaatcatgatggagaatgcacagctgcccccacaaatcgacaa
attgaaatcctggaactggaagatctggagaaagagtgttccttggctcgcatccgcctc
actttggctcagcatgatccatcagcggttgcagttgctggaagttcatcagcagaggaa
atggtcactctcttggttcaggcgggcctctttgacactgccatatcactctgtcagact
tttaagcttcccttaacgccagtctttgaagggcttgccttcaaatgcatcaaattgcaa
tttggaggagaggcagcacaagcagaagcctgggcctggctagcagccaatcagctctca
tctgtcatcactactaaggagtctagtgctacagatgaagcatggcgactattatccact
tacctggagaggtacaaagtccagaataacttgtatcaccactgtgtaatcaacaagctc
ttgtctcatggagtgcctctgcctaattggcttataaacagttacaagaaggttgatgct
gctgaattgcttcgtttatacttaaactatgaccttttagaagaagctgtggatttggtg
tcagaatatgtggatgctgtattgggaaaaggacatcaatacttcggaattgagtttcca
ctgtccgcaacagccccaatggtgtggcttccatactcctctattgatcagcttctccaa
gctctgggagagaacagtgccaacagtcacaacatcgcactgtcccagaaaatacttgac
aaattggaggactaccagcaaaaagttgataaggcaacacgggatttattatatcgtcgg
accttgtga

DBGET integrated database retrieval system