KEGG   Homo sapiens (human): 23339
Entry
23339             CDS       T01001                                 
Symbol
VPS39, TLP, VAM6, hVam6p
Name
(RefSeq) VPS39 subunit of HOPS complex
  KO
K20183  Vam6/Vps39-like protein vacuolar protein sorting-associated protein 39
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    23339 (VPS39)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23339 (VPS39)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    23339 (VPS39)
SSDB
Motif
Pfam: Vps39_2 Vps39_1 CNH Clathrin KCTD11_21_C
Other DBs
NCBI-GeneID: 23339
NCBI-ProteinID: NP_001288067
OMIM: 612188
HGNC: 20593
Ensembl: ENSG00000166887
Pharos: Q96JC1(Tbio)
UniProt: Q96JC1
Structure
LinkDB
Position
15:complement(42158701..42208304)
AA seq 886 aa
MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVVPADVASPESGSCN
RFEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTVSKAKGASLF
TCDLQHTETGEEVLRMCVAVKKKLQLYFWKDREFHELQGDFSVPDVPKSMAWCENSICVG
FKRDYYLIRVDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCA
LNWTDIPVAMEHQPPYIIAVLPRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASN
HFVWRLIPVPMATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQK
RFDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEKAHLALIDYL
TQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIIDTTLLKCYLHTNVALVAPLL
RLENNHCHIEESEHVLKKAHKYSELIILYEKKGLHEKALQVLVDQSKKANSPLKGHERTV
QYLQHLGTENLHLIFSYSVWVLRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLA
IPYLEHIIHVWEETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEY
RQKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVHILKDTRMAE
EYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLELLEPKANLQAALQVLELHHS
KLDTTKALNLLPANTQINDIRIFLEKVLEENAQKKRFNQVLKNLLHAEFLRVQEERILHQ
QVKCIITEEKVCMVCKKKIGNSAFARYPNGVVVHYFCSKEVNPADT
NT seq 2661 nt   +upstreamnt  +downstreamnt
atgcacgacgctttcgagccagtgccgatcctagaaaagctgcctctgcaaatcgactgt
ctggctgcctgggaggaatggcttcttgtgggaaccaaacaaggacatcttcttctctat
aggattcggaaggacgttgtgccagcagatgtagcatcacctgaaagcggcagttgcaac
agatttgaagtgacactagagaaatccaataagaacttctccaaaaagattcagcagatc
catgtggtttcccagtttaagattctggtcagcttgttagaaaataacatttatgtccat
gacctattgacatttcaacaaatcactacggtttcaaaggcaaagggagcatcactgttt
acttgtgacctccagcacacagagaccggtgaggaggtgttacggatgtgtgtggcagta
aaaaagaagctgcagctctatttctggaaggacagggaatttcatgaattgcagggggac
tttagtgtgccagatgtgcccaagtccatggcgtggtgtgaaaattctatctgtgtgggt
ttcaagagagactactacctaataagggtggatggaaaggggtccatcaaagagctcttt
ccaacaggaaaacagctggagcccttagttgcacctctggcagatggaaaagtggctgtg
ggccaggatgatctcaccgtggtactcaatgaggaagggatctgcacacagaaatgtgcc
ctgaactggacggacataccagtggccatggagcaccagcctccctacatcattgcagtg
ttgcctcgatatgttgagatccgaacatttgaaccgaggcttctggtccaaagcattgaa
ttgcaaaggccccgtttcattacctcaggaggatcaaacattatctatgtggccagcaat
cattttgtttggagactcatccctgtccccatggcaacccaaatccaacaacttctccag
gacaagcagtttgaattggctctgcagctcgcagaaatgaaagatgattctgacagtgaa
aagcagcaacaaattcatcacatcaagaacttgtatgccttcaacctcttctgccagaag
cgttttgatgagtccatgcaggtctttgctaaacttggcacagatcccacccatgtgatg
ggcctgtaccctgacctgctgcccacagactacagaaagcagttgcagtatcccaaccca
ttgcctgtgctctccggggctgaattggagaaggctcacttagctctgattgactacctg
acacagaaacgaagtcaattggtaaagaagctgaatgactctgatcaccagtcaagcacc
tcaccgctcatggaaggcactcccaccatcaaatccaagaagaagctgctacaaatcatc
gacaccaccctgctcaagtgctatctccatacaaatgtggccctggtggcccccttgcta
cgcctggagaacaatcactgccacatcgaggagagcgagcacgtgctaaagaaggctcac
aagtacagtgagcttatcatcctgtatgagaagaaggggctccacgagaaagctctgcag
gtgctcgtggaccagtccaagaaagccaactcccctctgaaaggccacgagaggacagtg
cagtatctgcagcatctgggcacagaaaacctgcatttgattttctcctactcagtgtgg
gtgctgagagacttcccagaagatggcctgaagatatttactgaagatctcccggaagtg
gagtctctgccacgtgatcgagtcctcggcttcttaatagagaattttaagggtctggct
attccttatctggaacacatcatccatgtttgggaggagacaggctctcggttccacaac
tgcctgatccagctatactgtgagaaggtgcaaggtctgatgaaggagtatctcctgtcc
ttccctgcaggcaaaaccccagtcccagctggagaggaagagggtgagctgggagaatac
cggcaaaagctcctcatgttcttggagatttccagctactatgatccaggccggctcatc
tgtgattttccctttgatggcctcttagaagaacgagctctcctgttggggcgcatgggg
aaacatgaacaagctcttttcatttatgtccacatcttgaaggatacaaggatggctgag
gagtactgccacaaacactatgaccgaaacaaagatggcaacaaagatgtgtatctgtcc
ctgcttcggatgtacctgtcgccccccagcattcactgcctggggccaatcaagctggaa
ctactggagccaaaagccaacctccaggccgctctgcaggtcctcgagctacaccacagc
aaactggacaccaccaaggccctcaaccttctgccagcaaacactcagatcaatgacata
cgcatcttcctggaaaaggtcttggaagaaaatgcacaaaagaaacggttcaatcaagtg
ctcaagaaccttctccatgcagaattcctgagggtccaggaagagcggattttacaccag
caggtgaagtgcatcatcacagaggagaaggtgtgcatggtgtgtaagaagaagattggg
aacagtgcatttgcaagataccccaatggagtggtcgtccattacttctgttccaaagag
gtaaacccagctgacacttga

KEGG   Homo sapiens (human): 27072
Entry
27072             CDS       T01001                                 
Symbol
VPS41, HVPS41, HVSP41, SCAR29, hVps41p
Name
(RefSeq) VPS41 subunit of HOPS complex
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    27072 (VPS41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27072 (VPS41)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    27072 (VPS41)
SSDB
Motif
Pfam: Clathrin ANAPC4_WD40 Vps39_2 Vps39_1 zf-RING_5 zf-RING_2 zf-rbx1 zf-RING_11
Other DBs
NCBI-GeneID: 27072
NCBI-ProteinID: NP_055211
OMIM: 605485
HGNC: 12713
Ensembl: ENSG00000006715
Pharos: P49754(Tbio)
UniProt: P49754
LinkDB
Position
7:complement(38722974..38909191)
AA seq 854 aa
MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLAL
GTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFH
ETFDCPIKIIAVHPHFVRSSCKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWR
GHLIAWANNMGVKIFDIISKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKV
CSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTEREYCA
RPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVSPRDVVVAKER
DQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQK
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLI
REWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVF
QLIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHK
LFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLL
SRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTH
VDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQM
KGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSA
KNRGPGSAILEMKK
NT seq 2565 nt   +upstreamnt  +downstreamnt
atggcggaagcagaggagcaggaaactgggtcccttgaagaatctacagatgagtctgag
gaagaagagagcgaagaggaacccaagctgaagtatgaaaggctttccaatggggtaact
gaaatacttcagaaggatgcagctagctgcatgacagtccatgacaagtttttggcattg
ggcacacattatggcaaggtttatttacttgatgtccaggggaacatcactcagaagttt
gatgtaagtcctgtgaagataaatcagattagcttggatgaaagtggagagcacatgggt
gtgtgttcagaggatggcaaggtgcaggtatttggactgtattctggagaagaatttcac
gagacttttgactgtcccattaaaattattgctgtgcacccacatttcgtgagatccagt
tgcaagcagtttgtgaccggagggaagaagctgctactgtttgaacggtcttggatgaac
agatggaagtctgctgttctgcatgaaggggaagggaacataaggagtgtgaagtggaga
ggccatctgattgcttgggccaataatatgggtgtgaagatttttgacatcatctcaaag
caaagaatcaccaatgtgccccgggatgatataagtcttcgcccagacatgtatccctgc
agcctctgctggaaggacaatgtgacactgattattggctgggggacttctgtcaaggtg
tgctcagtgaaggaacggcatgccagtgaaatgagggatttgccaagtcgatatgttgaa
atagtgtctcagtttgaaactgaattctacatcagtggacttgcacctctctgtgatcag
cttgttgtactttcgtatgtaaaggagatttcagaaaaaacggaaagagaatactgtgcc
aggcctagactggacatcatccagccactttctgagacttgtgaagagatctcttctgat
gctttgacagtcagaggctttcaggagaatgaatgtagagattatcatttagaatactct
gaaggggaatcacttttttacatcgtgagtccgagagatgttgtagtggccaaggaacga
gaccaagatgatcacattgactggctccttgaaaagaagaaatatgaagaagcattgatg
gcagctgaaattagccaaaaaaatattaaaagacataagattctggatattggcttggca
tatataaatcacctggtggagagaggagactatgacatagcagcacgcaaatgccagaaa
attcttgggaaaaatgcagcactctgggaatatgaagtttataaatttaaagaaattgga
cagcttaaggctattagtccttatttgccaagaggtgatccagttctgaaaccactcatc
tatgaaatgatcttacatgaatttttggagagtgattatgagggttttgccacattgatc
cgagaatggcctggagatctgtataataattcagtcatagttcaagcagttcgggatcat
ttgaagaaagatagtcagaacaagactttacttaaaaccctggcagaattgtacacctat
gacaagaactatggcaatgctctggaaatatacttaacattaagacataaagacgttttt
cagttgatccacaagcataatcttttcagttctatcaaggataaaattgttttattaatg
gattttgattcagagaaagctgttgacatgcttttggacaatgaagataaaatttcaatt
aaaaaggtagtggaagaattggaagacagaccagagctacagcatgtgtatttgcataag
cttttcaagagagaccaccataaggggcagcgttaccatgaaaaacagatcagtctttat
gctgaatatgatcgaccaaacttacttccctttctccgagacagtacccattgcccactt
gaaaaggctcttgagatctgtcaacagagaaactttgtagaagagacagtttatcttctg
agccgaatgggtaatagccgaagtgccctgaagatgattatggaggaattacatgatgtt
gataaagcaatcgaatttgccaaggagcaagatgatggagagctgtgggaagatttgatt
ttatattccattgacaaaccaccatttattactggcttgttaaacaacattggcacacat
gttgacccaattctactgattcaccgtattaaggaaggaatggagatccccaatttgaga
gattccttggttaaaattctgcaagactacaatttgcaaattctgcttcgtgaaggctgc
aagaagattctcgtagctgactctttgtccttactgaagaaaatgcaccgaactcaaatg
aaaggtgttcttgttgatgaggagaacatctgtgagtcgtgcctttcccctattcttcca
tcagatgcagctaagcccttcagcgtggtggtcttccattgccggcacatgttccacaag
gagtgcctgcccatgcccagcatgaactctgctgcacagttctgcaacatctgcagtgct
aagaaccgtggaccaggaagtgcaattttggagatgaaaaaatag

KEGG   Homo sapiens (human): 55823
Entry
55823             CDS       T01001                                 
Symbol
VPS11, END1, HLD12, DYT32, PEP5, RNF108, hVPS11
Name
(RefSeq) VPS11 core subunit of CORVET and HOPS complexes
  KO
K20179  vacuolar protein sorting-associated protein 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Disease
H00679  Hypomyelinating leukodystrophy
H00831  Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    55823 (VPS11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55823 (VPS11)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    55823 (VPS11)
   Hops complex
    55823 (VPS11)
SSDB
Motif
Pfam: VPS11_C Clathrin zf-C3HC4_2 zf-RING_2 zf-rbx1 zf-C3HC4 zf-C3H2C3 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 TPR_11 DLP_helical zf-ANAPC11 DUF5847 zf-RING_11
Other DBs
NCBI-GeneID: 55823
NCBI-ProteinID: NP_068375
OMIM: 608549
HGNC: 14583
Ensembl: ENSG00000160695
Pharos: Q9H270(Tbio)
UniProt: Q9H270 B7Z879 A0A087WXL6
LinkDB
Position
11:119067818..119081972
AA seq 941 aa
MAAYLQWRRFVFFDKELVKEPLSNDGAAPGATPASGSAASKFLCLPPGITVCDSGRGSLV
FGDMEGQIWFLPRSLQLTGFQAYKLRVTHLYQLKQHNILASVGEDEEGINPLVKIWNLEK
RDGGNPLCTRIFPAIPGTEPTVVSCLTVHENLNFMAIGFTDGSVTLNKGDITRDRHSKTQ
ILHKGNYPVTGLAFRQAGKTTHLFVVTTENVQSYIVSGKDYPRVELDTHGCGLRCSALSD
PSQDLQFIVAGDECVYLYQPDERGPCFAFEGHKLIAHWFRGYLIIVSRDRKVSPKSEFTS
RDSQSSDKQILNIYDLCNKFIAYSTVFEDVVDVLAEWGSLYVLTRDGRVHALQEKDTQTK
LEMLFKKNLFEMAINLAKSQHLDSDGLAQIFMQYGDHLYSKGNHDGAVQQYIRTIGKLEP
SYVIRKFLDAQRIHNLTAYLQTLHRQSLANADHTTLLLNCYTKLKDSSKLEEFIKKKSES
EVHFDVETAIKVLRQAGYYSHALYLAENHAHHEWYLKIQLEDIKNYQEALRYIGKLPFEQ
AESNMKRYGKILMHHIPEQTTQLLKGLCTDYRPSLEGRSDREAPGCRANSEEFIPIFANN
PRELKAFLEHMSEVQPDSPQGIYDTLLELRLQNWAHEKDPQVKEKLHAEAISLLKSGRFC
DVFDKALVLCQMHDFQDGVLYLYEQGKLFQQIMHYHMQHEQYRQVISVCERHGEQDPSLW
EQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQ
KQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGH
SFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLKCSNDSFSVIAD
YFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggcggcctacctgcagtggcggcgcttcgttttcttcgacaaggagctggtgaaggag
ccgctgagcaatgatggggccgctcccggggccacacctgcttctggatccgctgcttcc
aagttcctttgcctccctcctggcatcactgtctgcgactcaggccgagggagcctggtc
tttggagatatggaaggccagatctggttcttgccacgttccctacagcttacaggcttc
caagcctacaaactacgggtgacacacctgtaccaactgaagcagcacaatattctggca
tctgttggagaagatgaagagggcatcaaccccttggttaagatctggaacctggagaag
agagatggtggcaatccactctgcactcgaatcttccctgctattccaggaacagagcca
actgttgtatcttgtttgactgtccatgaaaatctcaactttatggccattggtttcaca
gatggcagtgttacattgaacaaaggagacatcacccgggaccggcatagcaagacccag
attttgcacaagggcaactatcctgtaactggattggcctttcgccaagcaggaaagacc
actcacttgtttgttgtgacaacagagaacgtccagtcctatatagtttctggaaaagac
taccctcgcgtggagttggacacccatggttgtggcctgcgctgctcagccctaagtgac
ccttctcaggacctgcagttcattgtggccggggatgagtgtgtctacttgtaccagcct
gatgaacgtgggccctgcttcgcctttgagggccataagctcattgcccactggtttaga
ggctaccttatcattgtctcccgtgaccggaaggtttctcccaagtcagagtttaccagc
agggattcacagagctccgacaagcagattctaaacatctatgacctgtgcaacaagttc
atagcctatagcaccgtctttgaggatgtagtggatgtgcttgctgagtggggctccctg
tacgtgctgacgcgggatgggcgggtccacgcactgcaggagaaggacacacagaccaaa
ctggagatgctgtttaagaagaacctatttgagatggcgattaaccttgccaagagccag
catctggacagtgatgggctggcccagattttcatgcagtatggagaccatctctacagc
aagggcaaccacgatggggctgtccagcaatatatccgaaccattggaaagttggagcca
tcctacgtgatccgcaagtttctggatgcccagcgcattcacaacctgactgcctacctg
cagaccctgcaccgacaatccctggccaatgccgaccataccaccctgctcctcaactgc
tataccaagctcaaggacagctcgaagctggaggagttcatcaagaaaaagagtgagagt
gaagtccactttgatgtggagacagccatcaaggtcctccggcaggctggctactactcc
catgccctgtatctggcggagaaccatgcacatcatgagtggtacctgaagatccagcta
gaagacattaagaattatcaggaagcccttcgatacatcggcaagctgccttttgagcag
gcagagagcaacatgaagcgctacggcaagatcctcatgcaccacataccagagcagaca
actcagttgctgaagggactttgtactgattatcggcccagcctcgaaggccgcagcgat
agggaggccccaggctgcagggccaactctgaggagttcatccccatctttgccaataac
ccgcgagagctgaaagccttcctagagcacatgagtgaagtgcagccagactcaccccag
gggatctacgacacactccttgagctgcgactgcagaactgggcccacgagaaggatcca
caggtcaaagagaagcttcacgcagaggccatttccctgctgaagagtggtcgcttctgc
gacgtctttgacaaggccctggtcctgtgccagatgcacgacttccaggatggtgtcctt
tacctttatgagcaggggaagctgttccagcagatcatgcactaccacatgcagcacgag
cagtaccggcaggtcatcagcgtgtgtgagcgccatggggagcaggacccctccttgtgg
gagcaggccctcagctacttcgctcgcaaggaggaggactgcaaggagtatgtggcagct
gtcctcaagcatatcgagaacaagaacctcatgccacctcttctagtggtgcagaccctg
gcccacaactccacagccacactctccgtcatcagggactacctggtccaaaaactacag
aaacagagccagcagattgcacaggatgagctgcgggtgcggcggtaccgagaggagacc
acccgtatccgccaggagatccaagagctcaaggccagtcctaagattttccaaaagacc
aagtgcagcatctgtaacagtgccttggagttgccctcagtccacttcctgtgtggccac
tccttccaccaacactgctttgagagttactcggaaagtgatgctgactgccccacctgc
ctccctgaaaaccggaaggtcatggatatgatccgggcccaggaacagaaacgagatctc
catgatcaattccagcatcagctcaagtgctccaatgacagcttttctgtgattgctgac
tactttggcagaggtgttttcaacaaattgactctgctgaccgaccctcccacagccaga
ctgacctccagcctggaggctgggctgcaacgcgacctactcatgcactccaggaggggc
acttaa

KEGG   Homo sapiens (human): 57617
Entry
57617             CDS       T01001                                 
Symbol
VPS18, PEP3
Name
(RefSeq) VPS18 core subunit of CORVET and HOPS complexes
  KO
K20181  vacuolar protein sorting-associated protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    57617 (VPS18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    57617 (VPS18)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    57617 (VPS18)
   Hops complex
    57617 (VPS18)
SSDB
Motif
Pfam: Pep3_Vps18 Clathrin zf-C3HC4_2 zf-RING_16 zf-RING_5 Vps39_2 KNOX2 zf-ANAPC11 zf-RING_2 zf-RING_UBOX zf-rbx1 zf-RING_11
Other DBs
NCBI-GeneID: 57617
NCBI-ProteinID: NP_065908
OMIM: 608551
HGNC: 15972
Ensembl: ENSG00000104142
Pharos: Q9P253(Tbio)
UniProt: Q9P253 A0A024R9R3
LinkDB
Position
15:40894450..40903975
AA seq 973 aa
MASILDEYENSLSRSAVLQPGCPSVGIPHSGYVNAQLEKEVPIFTKQRIDFTPSERITSL
VVSSNQLCMSLGKDTLLRIDLGKANEPNHVELGRKDDAKVHKMFLDHTGSHLLIALSSTE
VLYVNRNGQKVRPLARWKGQLVESVGWNKALGTESSTGPILVGTAQGHIFEAELSASEGG
LFGPAPDLYFRPLYVLNEEGGPAPVCSLEAERGPDGRSFVIATTRQRLFQFIGRAAEGAE
AQGFSGLFAAYTDHPPPFREFPSNLGYSELAFYTPKLRSAPRAFAWMMGDGVLYGALDCG
RPDSLLSEERVWEYPEGVGPGASPPLAIVLTQFHFLLLLADRVEAVCTLTGQVVLRDHFL
EKFGPLKHMVKDSSTGQLWAYTERAVFRYHVQREARDVWRTYLDMNRFDLAKEYCRERPD
CLDTVLAREADFCFRQRRYLESARCYALTQSYFEEIALKFLEARQEEALAEFLQRKLASL
KPAERTQATLLTTWLTELYLSRLGALQGDPEALTLYRETKECFRTFLSSPRHKEWLFASR
ASIHELLASHGDTEHMVYFAVIMQDYERVVAYHCQHEAYEEALAVLARHRDPQLFYKFSP
ILIRHIPRQLVDAWIEMGSRLDARQLIPALVNYSQGGEVQQVSQAIRYMEFCVNVLGETE
QAIHNYLLSLYARGRPDSLLAYLEQAGASPHRVHYDLKYALRLCAEHGHHRACVHVYKVL
ELYEEAVDLALQVDVDLAKQCADLPEEDEELRKKLWLKIARHVVQEEEDVQTAMACLASC
PLLKIEDVLPFFPDFVTIDHFKEAICSSLKAYNHHIQELQREMEEATASAQRIRRDLQEL
RGRYGTVEPQDKCATCDFPLLNRPFYLFLCGHMFHADCLLQAVRPGLPAYKQARLEELQR
KLGAAPPPAKGSARAKEAEGGAATAGPSREQLKADLDELVAAECVYCGELMIRSIDRPFI
DPQRYEEEQLSWL
NT seq 2922 nt   +upstreamnt  +downstreamnt
atggcgtccatcctggatgagtacgagaactcgctgtcccgctcggccgtcttgcagccc
ggctgccctagcgtgggcatcccccactcggggtatgtgaatgcccagctggagaaggaa
gtgcccatcttcacaaagcagcgcattgacttcaccccttccgagcgcattaccagtctt
gtcgtctccagcaatcagctgtgcatgagcctgggcaaggatacactgctccgcattgac
ttgggcaaggcaaatgagcccaaccacgtggagctgggacgtaaggatgacgcaaaagtt
cacaagatgttccttgaccatactggctctcacctgctgattgccctgagcagcacggag
gtcctctacgtgaaccgaaatggacagaaggtacggccactagcacgctggaaggggcag
ctggtggagagtgtgggttggaacaaggcactgggcacggagagcagcacaggccccatc
ctggtcgggactgcccaaggccacatctttgaagcagagctctcagccagcgaaggtggg
cttttcggccctgctccggatctctacttccgcccattgtacgtgctaaatgaagaaggg
ggtccagcacctgtgtgctcccttgaggccgagcggggccctgatgggcgtagctttgtt
attgccaccactcggcagcgcctcttccagttcataggccgagcagcagagggggctgag
gcccagggtttctcagggctctttgcagcttacacggaccacccacccccattccgtgag
tttcccagcaacctgggctacagtgagttggccttctacacccccaagctgcgctccgca
ccccgggccttcgcctggatgatgggggatggtgtgttgtatggggcattggactgtggg
cgccctgactctctgctgagcgaggagcgagtctgggagtacccagagggggtagggcct
ggggccagcccacccctagccatcgtcttgacccagttccacttcctgctgctactggca
gaccgggtggaggcagtgtgcacactgaccgggcaggtggtgctgcgggatcacttcctg
gagaaatttgggccgctgaagcacatggtgaaggactcctccacaggccagctgtgggcc
tacactgagcgggctgtcttccgctaccacgtgcaacgggaggcccgagatgtctggcgc
acctatctggacatgaaccgcttcgatctggccaaagagtattgtcgagagcggcccgac
tgcctggacacggtcctggcccgggaggccgatttctgctttcgccagcgtcgctacctg
gagagcgcacgctgctatgccctgacccagagctactttgaggagattgccctcaagttc
ctggaggcccgacaggaggaggctctggctgagttcctgcagcgaaaactggccagtttg
aagccagccgaacgtacccaggccacactgctgaccacctggctgacagagctctacctg
agccggcttggggctctgcagggcgacccagaggccctgactctctaccgagaaaccaag
gaatgctttcgaaccttcctcagcagcccccgccacaaagagtggctctttgccagccgg
gcctctatccatgagctgctcgccagtcatggggacacagaacacatggtgtactttgca
gtgatcatgcaggactatgagcgggtggtggcttaccactgtcagcacgaggcctacgag
gaggccctggccgtgctcgcccgccaccgtgacccccagctcttctacaagttctcaccc
atcctcatccgtcacatcccccgccagcttgtagatgcctggattgagatgggcagccgg
ctggatgctcgtcagctcattcctgccctggtgaactacagccagggtggtgaggtccag
caggtgagccaggccatccgctacatggagttctgcgtgaacgtgctgggggagactgag
caggccatccacaactacctgctgtcactgtatgcccgtggccggccggactcactactg
gcctatctggagcaggctggggccagcccccaccgggtgcattacgacctcaagtatgcg
ctgcggctctgcgccgagcatggccaccaccgcgcttgtgtccatgtctacaaggtccta
gagctgtatgaggaggccgtggacctggccctgcaggtggatgtggacctggccaagcag
tgtgcagacctgcctgaggaggatgaggaattgcgcaagaagctgtggctgaagatcgca
cggcacgtggtgcaggaagaggaagatgtacagacagccatggcttgcctggctagctgc
cccttgctcaagattgaggatgtgctgcccttctttcctgatttcgtcaccatcgaccac
ttcaaggaggcgatctgcagctcacttaaggcctacaaccaccacatccaggagctgcag
cgggagatggaagaggctacagccagtgcccagcgcatccggcgagacctgcaggagctg
cggggccgctacggcactgtggagccccaggacaaatgtgccacctgcgacttccccctg
ctcaaccgccctttttacctcttcctctgtggccatatgttccatgctgactgcctgctg
caggctgtgcgacctggcctgccagcctacaagcaggcccggctggaggagctgcagagg
aagctgggggctgctccacccccagccaagggctctgcccgggccaaggaggccgagggt
ggggctgccacggcagggcccagccgggaacagctcaaggctgacctggatgagttggtg
gccgctgagtgtgtgtactgtggggagctgatgatccgctctatcgaccggccgttcatc
gacccccagcgctacgaggaggagcagctcagttggctgtag

KEGG   Homo sapiens (human): 64601
Entry
64601             CDS       T01001                                 
Symbol
VPS16, DYT30, hVPS16
Name
(RefSeq) VPS16 core subunit of CORVET and HOPS complexes
  KO
K20180  vacuolar protein sorting-associated protein 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Disease
H00831  Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64601 (VPS16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64601 (VPS16)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    64601 (VPS16)
   Hops complex
    64601 (VPS16)
SSDB
Motif
Pfam: Vps16_N Vps16_C FliO
Other DBs
NCBI-GeneID: 64601
NCBI-ProteinID: NP_072097
OMIM: 608550
HGNC: 14584
Ensembl: ENSG00000215305
Pharos: Q9H269(Tbio)
UniProt: Q9H269
Structure
LinkDB
Position
20:2840745..2866732
AA seq 839 aa
MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELRDCLVAAAPYGGPIALLRNPWRKEKAA
SVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFS
MGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANVGDLKLRRMPEVPGLQSAPSCW
TVLCQDRVAHILLAVGPDLYLLDHAACSAVTPPGLAPGVSSFLQMAVSFTYRHLALFTDT
GYIWMGTASLKEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQ
FVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLLEAQKEYEKES
QKADEYLREIQELGQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVH
MCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQG
VSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLE
YEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMA
LSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAALQTAADAFYK
AKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFR
IPDKRLWWLKLTALADLEDWEELEKFSKSKKSPIGYLPFVEICMKQHNKYEAKKYASRVG
PEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK
NT seq 2520 nt   +upstreamnt  +downstreamnt
atggactgctacacggcgaactggaacccactcggggactctgccttttaccggaaatat
gagctgtacagcatggactgggacctgaaggaggaactcagggattgcctggtggctgct
gcaccctatgggggccccattgcactgctgaggaacccctggcggaaggagaaagctgct
agtgtgaggccagtgctcgatatatactctgcttccggcatgcctctggccagcctgctg
tggaagagtggacccgtggtgtccctgggctggtcagctgaggaggagctgctctgtgtg
caggaagatggtgctgtactggtttatgggcttcatggtgacttccggagacacttcagc
atgggcaatgaagtgctccagaaccgggttctggatgcccggatctttcacactgagttt
ggttccggagtggccatcctcacaggggcccaccgcttcaccctcagtgccaatgtgggt
gacctcaaactccgccggatgccagaggtgccaggtctgcaaagtgcaccctcctgctgg
actgtgctgtgccaggaccgagtggcacacattcttctggctgtggggcctgacctttac
ctcttggaccatgcagcctgctccgcagtgacgccccctggcctggccccaggagtaagc
agcttcctacagatggctgtctccttcacctaccgacacctggcactcttcacagacaca
ggctacatctggatggggacagcatcactcaaggagaagctatgtgagttcaactgcaac
atccgggcacctccaaagcagatggtctggtgcagccgtcctcgtagcaaggagagggcc
gtggtggtggcctgggaaaggcggctgatggtggtgggcgatgcacccgagagcatccag
tttgtgctggatgaggactcctacctggtgcctgagctcgatggggtccgcatcttctcc
cgcagcacccacgagttcctgcatgaggttccagcggccagcgaggaaatcttcaaaatt
gcctcaatggcccccggggcgctgctcctggaggctcagaaggagtatgagaaagagagc
cagaaggcggacgagtacctgcgggagatccaggagctgggccagctgacccaggccgtg
cagcagtgcattgaggctgcaggacatgagcaccagccagacatgcagaagagtctgctc
agggccgcctccttcggaaagtgtttcctggacagatttccacccgacagcttcgtgcac
atgtgtcaggacctgcgtgtgctcaatgctgttcgggactatcacatcgggatcccgctc
acctatagccaatataagcagctcaccatccaggtgctgctggacaggctcgtgttgcgg
agactttaccccctggccatccagatatgcgagtacttgcgccttcctgaagtacagggc
gtcagcaggatcctggcccactgggcctgctacaaggtgcaacagaaggatgtctcagat
gaggatgtggctcgagccattaaccagaagctgggggacacgcctggtgtctcttactcc
gacattgctgcacgagcctatggttgtggccgcacggagctggccatcaagctgctggag
tatgagccacgctcaggggagcaggtaccccttctcctaaagatgaagaggagcaaactg
gcactaagcaaggccatcgagagcggggacactgacctggtgttcacggtgttgctgcac
ctgaagaacgagctgaaccgaggagattttttcatgacccttcggaatcagcccatggcc
ctcagtttgtaccgacagttctgtaagcatcaggagctagagacgctgaaggacctttac
aatcaggatgacaatcaccaggaattgggcagcttccacatccgagccagctatgctgca
gaagagcgtattgaggggcgagtagcagctctgcagacagccgccgatgccttctacaag
gccaagaatgagtttgcagccaaggctacagaggatcaaatgcggctcctacggctgcag
cggcgcctagaagacgagctggggggccagttcctagacctgtctctacatgacacagtt
accaccctcattcttggcggtcacaacaagcgtgcagagcagctggcacgtgacttccgc
atccctgacaagaggctctggtggctgaagctgactgccctggcagatttggaagattgg
gaagagctagagaagttttccaagagcaagaaatcacccattggctacctgccttttgtg
gagatctgcatgaaacaacataacaaatacgaagccaagaagtatgcttcccgcgtgggt
cccgagcagaaggtcaaggctttgcttcttgttggcgatgtggctcaggctgcagatgtg
gccatcgaacaccggaatgaggctgagctgagcctcgtattgtcccactgcacgggagcc
acagatggggccacagctgacaagattcaacgggccagggcacaagcccagaagaagtga

KEGG   Homo sapiens (human): 65082
Entry
65082             CDS       T01001                                 
Symbol
VPS33A, MPSPS
Name
(RefSeq) VPS33A core subunit of CORVET and HOPS complexes
  KO
K20182  vacuolar protein sorting-associated protein 33A
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Network
nt06125  Membrane trafficking (bacteria)
  Element
N01300  Tethering of late endosomes and lysosomes
N01301  Salmonella SifA to Tethering of late endosomes and lysosomes
Disease
H02205  Mucopolysaccharidosis-plus syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    65082 (VPS33A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    65082 (VPS33A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   CORVET complex
    65082 (VPS33A)
   Hops complex
    65082 (VPS33A)
SSDB
Motif
Pfam: Sec1 DUF1629 Pectinesterase
Other DBs
NCBI-GeneID: 65082
NCBI-ProteinID: NP_075067
OMIM: 610034
HGNC: 18179
Ensembl: ENSG00000139719
Pharos: Q96AX1(Tbio)
UniProt: Q96AX1
Structure
LinkDB
Position
12:complement(122229564..122266494)
AA seq 596 aa
MAAHLSYGRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEV
EKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLL
CEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLM
TLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPL
ATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIR
DKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAEL
IKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGL
KQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTGGRNNYPTIRKTLRLWMDDVNEQ
NPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPG
ENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALMEKPF
NT seq 1791 nt   +upstreamnt  +downstreamnt
atggcggctcatctgtcctacggccgagtgaacctaaacgtgttgcgcgaggcggtgcgt
cgcgagctgcgcgagttcctggacaagtgcgcaggaagcaaggcaatagtttgggatgaa
tacctaactggaccctttggcctgattgcacagtattcactattgaaggaacatgaagtg
gaaaaaatgttcacacttaaaggaaatcgtttgccggcagctgatgtgaagaatataatt
ttttttgtcagacccaggctagagttgatggatataatcgctgaaaacgtgctcagtgaa
gatagacgaggcccaacgagagattttcatattctgtttgtgccacgccgtagcctgttg
tgcgaacagcggttgaaggatctgggtgtcttgggatcctttattcacagggaggagtac
agcttagatctcattccattcgatggggatctcttatccatggaatcagagggtgcattc
aaagagtgctacctggagggtgaccagacgagcctgtaccacgcagccaaggggctgatg
accctgcaagctctgtatggaacgatcccccagatctttgggaaaggagaatgcgctcgg
caagtggccaatatgatgatcaggatgaagagagagtttacaggaagccagaattcaata
tttcctgtttttgataatctcttgttgcttgatcggaatgtggatttattaacacctctt
gccactcagctgacatatgaaggactcattgatgaaatttatggcattcagaacagttat
gtgaaattacctccagagaaatttgcacctaagaaacagggcgatggtggtaaggacctc
cccacggaagcaaagaagctgcagctgaattctgcagaggagctctatgctgagatccga
gataagaacttcaacgcagttggctctgtgctcagcaagaaagcaaagatcatctctgca
gcattcgaggaaagacacaatgctaagaccgtgggggagatcaagcagtttgtttcccag
ttgccccacatgcaggcagcaaggggctcgcttgcaaaccatacctcaattgcagaattg
atcaaagatgtcactacttctgaagacttttttgataaattaaccgtggaacaggagttt
atgtctggaatagacactgataaggtcaacaattacattgaggattgtatcgcccaaaag
cactcgttgatcaaggtgttaagactagtttgcctccaatccgtgtgtaatagtgggctc
aaacaaaaagttttggattattacaaaagagagattctccagacatacggctatgagcac
atattgaccttacacaacctggagaaggccggcctgctgaaaccgcagacggggggcaga
aacaattacccaactatacggaaaacattacgcctctggatggatgatgttaatgagcaa
aaccccacggacatatcgtatgtgtacagtgggtatgccccgctcagtgtgcggctggcc
cagctgctttcccggcctggctggcggagcatcgaggaggtcctccgcatcctcccaggg
ccccactttgaggagcggcagccactgcccacaggactgcagaagaaacgtcaaccggga
gaaaaccgagtgactctgatatttttccttgggggcgtaaccttcgctgaaattgctgcc
ctgcgatttctctcccagttggaagatggaggtacagaatatgtcattgccaccactaaa
ctaatgaatggaaccagttggatagaggctctgatggaaaaacctttctag

DBGET integrated database retrieval system