KEGG   Homo sapiens (human): 23462
Entry
23462             CDS       T01001                                 
Symbol
HEY1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, NERP2, OAF1, hHRT1
Name
(RefSeq) hes related family bHLH transcription factor with YRPW motif 1
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
nt06465  Prion disease
nt06511  NOTCH signaling
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    23462 (HEY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23462 (HEY1)
  09162 Cancer: specific types
   05224 Breast cancer
    23462 (HEY1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    23462 (HEY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    23462 (HEY1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    23462 (HEY1)
SSDB
Motif
Pfam: HLH Hairy_orange HTH_Crp_2 dCache_2
Other DBs
NCBI-GeneID: 23462
NCBI-ProteinID: NP_036390
OMIM: 602953
HGNC: 4880
Ensembl: ENSG00000164683
Pharos: Q9Y5J3(Tbio)
UniProt: Q9Y5J3
Structure
LinkDB
Position
8:complement(79764010..79767767)
AA seq 304 aa
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagcgagctcaccccgagtacagctcctcggacagcgagctggacgagaccatcgag
gtggagaaggagagtgcggacgagaatggaaacttgagttcggctctaggttccatgtcc
ccaactacatcttcccagattttggccagaaaaagacggagaggaataattgagaagcgc
cgacgagaccggatcaataacagtttgtctgagctgagaaggctggtacccagtgctttt
gagaagcagggatctgctaagctagaaaaagccgagatcctgcagatgaccgtggatcac
ctgaaaatgctgcatacggcaggagggaaaggttactttgacgcgcacgcccttgctatg
gactatcggagtttgggatttcgggaatgcctggcagaagttgcgcgttatctgagcatc
attgaaggactagatgcctctgacccgcttcgagttcgactggtttcgcatctcaacaac
tacgcttcccagcgggaagccgcgagcggcgcccacgcgggcctcggacacattccctgg
gggaccgtcttcggacatcacccgcacatcgcgcacccgctgttgctgccccagaacggc
cacgggaacgcgggcaccacggcctcacccacggaaccgcaccaccagggcaggctgggc
tcggcacatccggaggcgcctgctttgcgagcgccccctagcggcagcctcggaccggtg
ctccctgtggtcacctccgcctccaaactgtcgccgcctctgctctcctcagtggcctcc
ctgtcggccttccccttctctttcggctccttccacttactgtctcccaatgcactgagc
ccttcagcacccacgcaggctgcaaaccttggcaagccctatagaccttgggggacggag
atcggagctttttaa

DBGET integrated database retrieval system