KEGG   Homo sapiens (human): 2730
Entry
2730              CDS       T01001                                 
Symbol
GCLM, GLCLR
Name
(RefSeq) glutamate-cysteine ligase modifier subunit
  KO
K11205  glutamate--cysteine ligase regulatory subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
hsa04216  Ferroptosis
Module
hsa_M00118  Glutathione biosynthesis, glutamate => glutathione
Network
nt06026  Glutathione biosynthesis
  Element
N00899  Glutathione biosynthesis
Disease
H01730  Myocardial infarction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2730 (GCLM)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2730 (GCLM)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    2730 (GCLM)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 2730
NCBI-ProteinID: NP_002052
OMIM: 601176
HGNC: 4312
Ensembl: ENSG00000023909
Pharos: P48507(Tbio)
UniProt: P48507
LinkDB
Position
1:complement(93885199..93909430)
AA seq 274 aa
MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
NT seq 825 nt   +upstreamnt  +downstreamnt
atgggcaccgacagccgcgcggccaaggcgctcctggcgcgggcccgcaccctgcacctg
cagacggggaacctgctgaactggggccgcctgcggaagaagtgcccgtccacgcacagc
gaggagcttcatgattgtatccaaaaaaccttgaatgaatggagttcccaaatcaaccca
gatttggtcagggagtttccagatgtcttggaatgcactgtatctcatgcagtagaaaag
ataaatcctgatgaaagagaagaaatgaaagtttctgcaaaactgttcattgtagaatca
aactcttcatcatcaactagaagtgcagttgacatggcctgttcagtccttggagttgca
cagctggattctgtgatcattgcttcacctcctattgaagatggagttaatctttccttg
gagcatttacagccttactgggaggaattagaaaacttagttcagagcaaaaagattgtt
gccataggtacctctgatctagacaaaacacagttggaacagctgtatcagtgggcacag
gtaaaaccaaatagtaaccaagttaatcttgcctcctgctgtgtgatgccaccagatttg
actgcatttgctaaacaatttgacatacagctgttgactcacaatgatccaaaagaactg
ctttctgaagcaagtttccaagaagctcttcaggaaagcattcctgacattcaagcgcac
gagtgggtgccgctgtggctactgcggtattcggtcattgtgaaaagtagaggaattatc
aaatcaaaaggctacattttacaagctaaaagaaggggttcttaa

DBGET integrated database retrieval system