KEGG   Homo sapiens (human): 27301
Entry
27301             CDS       T01001                                 
Symbol
APEX2, APE2, APEXL2, XTH2, ZGRF2
Name
(RefSeq) apurinic/apyrimidinic endodeoxyribonuclease 2
  KO
K10772  AP endonuclease 2 [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01433  Base excision and strand cleavage by monofunctional glycosylase
N01434  Base excision and strand cleavage by bifunctional glycosylase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    27301 (APEX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27301 (APEX2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     27301 (APEX2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     27301 (APEX2)
SSDB
Motif
Pfam: Exo_endo_phos zf-GRF Exo_endo_phos_2
Other DBs
NCBI-GeneID: 27301
NCBI-ProteinID: NP_055296
OMIM: 300773
HGNC: 17889
Ensembl: ENSG00000169188
Pharos: Q9UBZ4(Tbio)
UniProt: Q9UBZ4 E5KN95
LinkDB
Position
X:55000363..55009057
AA seq 518 aa
MLRVVSWNINGIRRPLQGVANQEPSNCAAVAVGRILDELDADIVCLQETKVTRDALTEPL
AIVEGYNSYFSFSRNRSGYSGVATFCKDNATPVAAEEGLSGLFATQNGDVGCYGNMDEFT
QEELRALDSEGRALLTQHKIRTWEGKEKTLTLINVYCPHADPGRPERLVFKMRFYRLLQI
RAEALLAAGSHVIILGDLNTAHRPIDHWDAVNLECFEEDPGRKWMDSLLSNLGCQSASHV
GPFIDSYRCFQPKQEGAFTCWSAVTGARHLNYGSRLDYVLGDRTLVIDTFQASFLLPEVM
GSDHCPVGAVLSVSSVPAKQCPPLCTRFLPEFAGTQLKILRFLVPLEQSPVLEQSTLQHN
NQTRVQTCQNKAQVRSTRPQPSQVGSSRGQKNLKSYFQPSPSCPQASPDIELPSLPLMSA
LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCGGHREPCVMRT
VKKPGPNLGRRFYMCARPRGPPTDPSSRCNFFLWSRPS
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgttgcgcgtggtgagctggaacatcaatgggattcggagacccctgcaaggggtggca
aatcaggaacccagcaactgtgccgccgtggccgtggggcgcattttggacgagctggat
gcggatatcgtctgtctccaggaaaccaaagtgaccagggatgcactgacagagcccctg
gctatcgttgagggttataactcctatttcagcttcagccgcaaccgtagcggctattct
ggtgtagccaccttctgtaaggacaatgctaccccagtggctgctgaagaaggcctgagt
ggcctgtttgccacccagaatggggatgttggttgctatggaaacatggatgagtttacc
caagaggaactccgggctctggatagtgagggcagggccctcctcacacagcataagatc
cgcacatgggaaggtaaggagaagaccttgaccctaatcaacgtgtactgcccccatgcg
gaccctgggaggcctgagcggctagtctttaagatgcgcttctatcgtttgctgcaaatc
cgagcagaagccctcctggcggcaggcagccatgtgatcattctgggtgacctgaataca
gcccaccgccccattgaccactgggatgcagtcaacctggaatgctttgaagaggaccca
gggcgcaagtggatggacagcttgctcagtaacttggggtgccagtctgcctctcatgta
gggcccttcatcgatagctaccgctgcttccaaccaaagcaggagggggccttcacctgc
tggtcagcagtcactggcgcccgccatctcaactatggctcccggcttgactatgtgctg
ggggacaggaccctggtcatagacacctttcaggcctctttcctgctgcctgaggtgatg
ggctctgaccactgccctgtgggtgcagtcttgagtgtgtcctctgtgcctgcaaaacag
tgcccacctctgtgcacccgcttcctccctgagtttgcaggcacccagctcaagatcctt
cgcttcctagttcctctcgaacaaagtcctgtgttggagcagtcgacgctgcagcacaac
aatcaaacccgggtacagacatgccaaaacaaagcccaagtgcgctcaaccaggcctcag
cccagtcaggttggctctagcagaggccagaaaaacctgaagagctactttcagccctcc
cctagctgtccccaagcctctcctgacatagagctgcctagcctaccactgatgagcgcc
ctcatgaccccgaagactccagaagagaaggcagtggccaaagtggtgaaggggcaggcc
aagacttcagaagccaaagatgagaaggagttacggacctcattctggaagtctgtgctg
gcggggcccttgcgcacacccctctgtgggggccacagggagccatgtgtgatgcgtact
gtgaagaagccaggacccaacttgggccgccgcttctacatgtgtgccaggccccggggt
cctcccactgacccctcctcccggtgcaacttcttcctctggagcaggcccagctga

KEGG   Homo sapiens (human): 328
Entry
328               CDS       T01001                                 
Symbol
APEX1, APE, APE1, APEN, APEX, APX, HAP1, REF1
Name
(RefSeq) apurinic/apyrimidinic endodeoxyribonuclease 1
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01433  Base excision and strand cleavage by monofunctional glycosylase
N01434  Base excision and strand cleavage by bifunctional glycosylase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    328 (APEX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    328 (APEX1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     328 (APEX1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     328 (APEX1)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2
Other DBs
NCBI-GeneID: 328
NCBI-ProteinID: NP_001231178
OMIM: 107748
HGNC: 587
Ensembl: ENSG00000100823
Pharos: P27695(Tchem)
UniProt: P27695 Q5TZP7
Structure
LinkDB
Position
14:20455226..20457767
AA seq 318 aa
MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPA
TLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWS
APSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLV
RLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGF
GELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKI
RSKALGSDHCPITLYLAL
NT seq 957 nt   +upstreamnt  +downstreamnt
atgccgaagcgtgggaaaaagggagcggtggcggaagacggggatgagctcaggacagag
ccagaggccaagaagagtaagacggccgcaaagaaaaatgacaaagaggcagcaggagag
ggcccagccctgtatgaggaccccccagatcagaaaacctcacccagtggcaaacctgcc
acactcaagatctgctcttggaatgtggatgggcttcgagcctggattaagaagaaagga
ttagattgggtaaaggaagaagccccagatatactgtgccttcaagagaccaaatgttca
gagaacaaactaccagctgaacttcaggagctgcctggactctctcatcaatactggtca
gctccttcggacaaggaagggtacagtggcgtgggcctgctttcccgccagtgcccactc
aaagtttcttacggcataggcgatgaggagcatgatcaggaaggccgggtgattgtggct
gaatttgactcgtttgtgctggtaacagcatatgtacctaatgcaggccgaggtctggta
cgactggagtaccggcagcgctgggatgaagcctttcgcaagttcctgaagggcctggct
tcccgaaagccccttgtgctgtgtggagacctcaatgtggcacatgaagaaattgacctt
cgcaaccccaaggggaacaaaaagaatgctggcttcacgccacaagagcgccaaggcttc
ggggaattactgcaggctgtgccactggctgacagctttaggcacctctaccccaacaca
ccctatgcctacaccttttggacttatatgatgaatgctcgatccaagaatgttggttgg
cgccttgattactttttgttgtcccactctctgttacctgcattgtgtgacagcaagatc
cgttccaaggccctcggcagtgatcactgtcctatcaccctatacctagcactgtga

DBGET integrated database retrieval system