KEGG   Homo sapiens (human): 2846
Entry
2846              CDS       T01001                                 

Symbol
LPAR4, GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Name
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2846 (LPAR4)
   04072 Phospholipase D signaling pathway
    2846 (LPAR4)
   04151 PI3K-Akt signaling pathway
    2846 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2846 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2846 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2846 (LPAR4)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2846 (LPAR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2846 (LPAR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    2846 (LPAR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2846
NCBI-ProteinID: NP_001264929
OMIM: 300086
HGNC: 4478
Ensembl: ENSG00000147145
Vega: OTTHUMG00000021895
Pharos: Q99677(Tchem)
UniProt: Q99677
LinkDB
Position
Xq21.1
AA seq 370 aa
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagattcaaattcaagcctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctcaatggtgctgtctacagtgttgtattcatcttgggtctgataaccaacagtgtctct
ctgtttgtcttctgtttccgcatgaaaatgagaagtgagactgctatttttatcaccaat
ctagctgtctctgatttgctttttgtctgtacactaccttttaaaatattttacaacttc
aaccgccactggccttttggtgacaccctctgcaagatctctggaactgcattccttacc
aacatctatgggagcatgctctttctcacctgtattagtgtggatcgtttcctggccatt
gtctatccttttcgatctcgtactattaggactaggaggaattctgccattgtgtgtgct
ggtgtctggatcctagtcctcagtggcggtatttcagcctctttgttttccaccactaat
gtcaacaatgcaaccaccacctgctttgaaggcttctccaaacgtgtctggaagacttat
ttatccaagatcacaatatttattgaagttgttgggtttatcattcctctaatattgaat
gtctcttgctcttctgtggtgctgagaactcttcgcaagcctgctactctgtctcaaatt
gggaccaataagaaaaaagtactgaaaatgatcacagtacatatggcagtctttgtggta
tgctttgtaccctacaactctgtcctcttcttgtatgccctggtgcgctcccaagctatt
actaattgctttttggaaagatttgcaaagatcatgtacccaatcaccttgtgccttgca
actctgaactgttgttttgaccctttcatctattacttcacccttgaatcctttcagaag
tccttctacatcaatgcccacatcagaatggagtccctgtttaagactgaaacacctttg
accacaaagccttcccttccagctattcaagaggaagtgagtgatcaaacaacaaataat
ggtggtgaattaatgctagaatccaccttttag

DBGET integrated database retrieval system