KEGG   Homo sapiens (human): 284716
Entry
284716            CDS       T01001                                 
Symbol
RIMKLA, FAM80A, NAAGS, NAAGS-II, NAAGS2
Name
(RefSeq) ribosomal modification protein rimK like family member A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    284716 (RIMKLA)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     284716 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     284716 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 284716
NCBI-ProteinID: NP_775913
OMIM: 618949
HGNC: 28725
Ensembl: ENSG00000177181
Pharos: Q8IXN7(Tdark)
UniProt: Q8IXN7
LinkDB
Position
1:42380792..42424232
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTMGAPPSMLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
cttatggaccagatcgccgtcaccatcgtcggcggccacctcggcctccagctaaaccag
aaggccctcaccactttcccggatgtggtgcttgtacgggtacccacaccctcagtgcag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgcccacagagcatcttaaattgcatcaacaaattctggacgttccaagaactggctgga
catggggtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
attgatgaagctgagcccctgggctacccagtcgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaggtcataggctctatgcttcgctgctccactgatgga
cggatgcagagcaactgctctctcggtggcgtgggcgtcaagtgtccgctgacagaacaa
ggcaagcagttggctattcaggtgtccaacatcctaggcatggacttctgtggcattgat
ctccttatcatggacgatggctcctttgtggtgtgtgaggcaaatgctaatgttggcttc
ctagcctttgaccaggcatgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaaataggcagactggaaagatggctgtcctcccaggactgtcgagtcca
agggagaagaacgagccggatggctgtgcttcagctcagggagttgcagagagcgtctat
accatcaacagtgggtctacctctagtgaaagtgagcctgaactgggagagatccgggat
tcctcagcaagcacaatgggggccccaccctccatgctgcccgaacctggctacaacatt
aacaacaggattgcttctgagttaaaacttaagtga

DBGET integrated database retrieval system