KEGG   Homo sapiens (human): 28514
Entry
28514             CDS       T01001                                 
Symbol
DLL1, DELTA1, DL1, Delta, NEDBAS
Name
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
nt06511  NOTCH signaling
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
N01479  Notch ligand ubiquitylation
Disease
H02470  Neurodevelopmental disorder with structural brain abnormalities
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    28514 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    28514 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    28514 (DLL1)
   05207 Chemical carcinogenesis - receptor activation
    28514 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    28514 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    28514 (DLL1)
SSDB
Motif
Pfam: MNNL EGF hEGF DSL EGF_3 EGF_2 EGF_CA ECSCR
Other DBs
NCBI-GeneID: 28514
NCBI-ProteinID: NP_005609
OMIM: 606582
HGNC: 2908
Ensembl: ENSG00000198719
Pharos: O00548(Tbio)
UniProt: O00548 A0A384P5C6
Structure
LinkDB
Position
6:complement(170282206..170291078)
AA seq 723 aa
MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSYSCTCPPGFYG
KICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQG
GPFPWVAVCAGVILVLMLLLGCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREK
DISVSIIGATQIKNTNKKADFHGDHSADKNGFKARYPAVDYNLVQDLKGDDTAVRDAHSK
RDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSKDTKYQSVYVISEEKDECVIA
TEV
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgggcagtcggtgcgcgctggccctggcggtgctctcggccttgctgtgtcaggtctgg
agctctggggtgttcgaactgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccaccgccgtgcgcctgccggaccttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagccgccctgcacctacggc
agcgccgtcacccccgtgctgggcgtcgactccttcagtctgcccgacggcgggggcgcc
gactccgcgttcagcaaccccatccgcttccccttcggcttcacctggccgggcaccttc
tctctgattattgaagctctccacacagattctcctgatgacctcgcaacagaaaaccca
gaaagactcatcagccgcctggccacccagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacggacctcaagtactcctaccgcttcgtgtgtgac
gaacactactacggagagggctgctccgttttctgccgtccccgggacgatgccttcggc
cacttcacctgtggggagcgtggggagaaagtgtgcaaccctggctggaaagggccctac
tgcacagagccgatctgcctgcctggatgtgatgagcagcatggattttgtgacaaacca
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgacgagtgtatccgctat
ccaggctgtctccatggcacctgccagcagccctggcagtgcaactgccaggaaggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggagccacctgcaccaacacgggccaggggagctacacttgctcttgccggcctgggtac
acaggtgccacctgcgagctggggattgacgagtgtgaccccagcccttgtaagaacgga
gggagctgcacggatctcgagaacagctactcctgtacctgcccacccggcttctacggc
aaaatctgtgaattgagtgccatgacctgtgcggacggcccttgctttaacgggggtcgg
tgctcagacagccccgatggagggtacagctgccgctgccccgtgggctactccggcttc
aactgtgagaagaaaattgactactgcagctcttcaccctgttctaatggtgccaagtgt
gtggacctcggtgatgcctacctgtgccgctgccaggccggcttctcggggaggcactgt
gacgacaacgtggacgactgcgcctcctccccgtgcgccaacgggggcacctgccgggat
ggcgtgaacgacttctcctgcacctgcccgcctggctacacgggcaggaactgcagtgcc
cccgtcagcaggtgcgagcacgcaccctgccacaatggggccacctgccacgagaggggc
caccgctatgtgtgcgagtgtgcccgaggctacgggggtcccaactgccagttcctgctc
cccgagctgcccccgggcccagcggtggtggacctcactgagaagctagagggccagggc
gggccattcccctgggtggccgtgtgcgccggggtcatccttgtcctcatgctgctgctg
ggctgtgccgctgtggtggtctgcgtccggctgaggctgcagaagcaccggcccccagcc
gacccctgccggggggagacggagaccatgaacaacctggccaactgccagcgtgagaag
gacatctcagtcagcatcatcggggccacgcagatcaagaacaccaacaagaaggcggac
ttccacggggaccacagcgccgacaagaatggcttcaaggcccgctacccagcggtggac
tataacctcgtgcaggacctcaagggtgacgacaccgccgtcagggacgcgcacagcaag
cgtgacaccaagtgccagccccagggctcctcaggggaggagaaggggaccccgaccaca
ctcaggggtggagaagcatctgaaagaaaaaggccggactcgggctgttcaacttcaaaa
gacaccaagtaccagtcggtgtacgtcatatccgaggagaaggatgagtgcgtcatagca
actgaggtgtaa

DBGET integrated database retrieval system