KEGG   Homo sapiens (human): 29086
Entry
29086             CDS       T01001                                 

Gene name
BABAM1, C19orf62, HSPC142, MERIT40, NBA1
Definition
(RefSeq) BRISC and BRCA1 A complex member 1
  KO
K20776  BRISC and BRCA1-A complex member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    29086 (BABAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29086 (BABAM1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29086 (BABAM1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    29086 (BABAM1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   BRISC complex
    29086 (BABAM1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    BRISC complex
     29086 (BABAM1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     29086 (BABAM1)
SSDB
Motif
Pfam: VWA_2
Other DBs
NCBI-GeneID: 29086
NCBI-ProteinID: NP_001028721
OMIM: 612766
HGNC: 25008
Ensembl: ENSG00000105393
Vega: OTTHUMG00000182755
Pharos: Q9NWV8(Tbio)
UniProt: Q9NWV8 A0A024R7L2
LinkDB
Structure
PDB: 
6H3C

Position
19p13.11
AA seq 329 aa
MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADD
GSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNA
LNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCST
FNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPY
FFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLA
HPLQRPCQSHASYSLLEEEDEAIEVEATV
NT seq 990 nt   +upstreamnt  +downstreamnt
atggaagtggcagagcccagcagccccactgaagaggaggaggaggaagaggagcactcg
gcagagcctcggccccgcactcgctccaatcctgaaggggctgaggaccgggcagtaggg
gcacaggccagcgtgggcagccgcagcgagggtgagggtgaggccgccagtgctgatgat
gggagcctcaacacttcaggagccggccctaagtcctggcaggtgcccccgccagcccct
gaggtccaaattcggacaccaagggtcaactgtccagagaaagtgattatctgcctggac
ctgtcagaggaaatgtcactgccaaagctggagtcgttcaacggctccaaaaccaacgcc
ctcaatgtctcccagaagatgattgagatgttcgtgcggacaaaacacaagatcgacaaa
agccacgagtttgcactggtggtggtgaacgatgacacggcctggctgtctggcctgacc
tccgacccccgcgagctctgtagctgcctctatgatctggagacggcctcctgttccacc
ttcaatctggaaggacttttcagcctcatccagcagaaaactgagcttccggtcacagag
aacgtgcagacgattcccccgccatatgtggtccgcaccatccttgtctacagccgtcca
ccttgccagccccagttctccttgacggagcccatgaagaaaatgttccagtgcccatat
ttcttctttgacgttgtttacatccacaatggcactgaggagaaggaggaggagatgagt
tggaaggatatgtttgccttcatgggcagcctggataccaagggtaccagctacaagtat
gaggtggcactggctgggccagccctggagttgcacaactgcatggcgaaactgttggcc
caccccctgcagcggccttgccagagccatgcttcctacagcctgctggaggaggaggat
gaagccattgaggttgaggccactgtctga

DBGET integrated database retrieval system