KEGG   Homo sapiens (human): 3028
Entry
3028              CDS       T01001                                 
Symbol
HSD17B10, 17b-HSD10, ABAD, CAMR, DUPXp11.22, ERAB, HADH2, HCD2, HSD10MD, MHBD, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1
Name
(RefSeq) hydroxysteroid 17-beta dehydrogenase 10
  KO
K08683  3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06024  Valine, leucine and isoleucine degradation
  Element
N00856  Isoleucine degradation
Disease
H00925  2-Methyl-3-hydroxybutyryl-CoA dehydrogenase (MHBD) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3028 (HSD17B10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3028 (HSD17B10)
   05022 Pathways of neurodegeneration - multiple diseases
    3028 (HSD17B10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    3028 (HSD17B10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3028 (HSD17B10)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     3028 (HSD17B10)
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     3028 (HSD17B10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    3028 (HSD17B10)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   3028 (HSD17B10)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Other DBs
NCBI-GeneID: 3028
NCBI-ProteinID: NP_004484
OMIM: 300256
HGNC: 4800
Ensembl: ENSG00000072506
Pharos: Q99714(Tbio)
UniProt: Q99714 A0A0S2Z410
Structure
LinkDB
Position
X:complement(53431258..53434376)
AA seq 261 aa
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVF
APADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDV
NLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTL
PIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAI
IENPFLNGEVIRLDGAIRMQP
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcagcagcgtgtcggagcgtgaagggcctggtggcggtaataaccggaggagcctcg
ggcctgggcctggccacggcggagcgacttgtggggcagggagcctctgctgtgcttctg
gacctgcccaactcgggtggggaggcccaagccaagaagttaggaaacaactgcgttttc
gccccagccgacgtgacctctgagaaggatgtgcaaacagctctggctctagcaaaagga
aagtttggccgtgtggatgtagctgtcaactgtgcaggcatcgcggtggctagcaagacg
tacaacttaaagaagggccagacccataccttggaagacttccagcgagttcttgatgtg
aatctcatgggcaccttcaatgtgatccgcctggtggctggtgagatgggccagaatgaa
ccagaccagggaggccaacgtggggtcatcatcaacactgccagtgtggctgccttcgag
ggtcaggttggacaagctgcatactctgcttccaaggggggaatagtgggcatgacactg
cccattgctcgggatctggctcccataggtatccgggtgatgaccattgccccaggtctg
tttggcaccccactgctgaccagcctcccagagaaagtgtgcaacttcttggccagccaa
gtgcccttccctagccgactgggtgaccctgctgagtatgctcacctcgtacaggccatc
atcgagaacccattcctcaatggagaggtcatccggctggatggggccattcgtatgcag
ccttga

DBGET integrated database retrieval system