KEGG   Homo sapiens (human): 3033
Entry
3033              CDS       T01001                                 
Symbol
HADH, HAD, HADH1, HADHSC, HCDH, HHF4, MSCHAD, SCHAD
Name
(RefSeq) hydroxyacyl-CoA dehydrogenase
  KO
K00022  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa00310  Lysine degradation
hsa00380  Tryptophan metabolism
hsa00650  Butanoate metabolism
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
hsa_M00085  Fatty acid elongation in mitochondria
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00804  beta-Oxidation
N00852  Valine degradation
N00856  Isoleucine degradation
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01267  Familial hyperinsulinemic hypoglycemia
H01364  3-Hydroxyacyl-CoA dehydrogenase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    3033 (HADH)
  09103 Lipid metabolism
   00062 Fatty acid elongation
    3033 (HADH)
   00071 Fatty acid degradation
    3033 (HADH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    3033 (HADH)
   00310 Lysine degradation
    3033 (HADH)
   00380 Tryptophan metabolism
    3033 (HADH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     3033 (HADH)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH Pyr_redox_2 UDPG_MGDP_dh_N Pyr_redox NAD_Gly3P_dh_N NAD_binding_2 DAO NAD_binding_7 AlaDh_PNT_C F420_oxidored GIDA 2-Hacid_dh_C NAD_binding_8 Sacchrp_dh_NADP XdhC_C FAD_oxidored
Other DBs
NCBI-GeneID: 3033
NCBI-ProteinID: NP_005318
OMIM: 601609
HGNC: 4799
Ensembl: ENSG00000138796
Pharos: Q16836(Tbio)
UniProt: Q16836 A0A140VK76
Structure
LinkDB
Position
4:107989889..108035171
AA seq 314 aa
MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTE
DILAKSKKGIEESLRKVAKKKFAENLKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAI
VENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKL
VEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDAS
KEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAEN
KFGKKTGEGFYKYK
NT seq 945 nt   +upstreamnt  +downstreamnt
atggccttcgtcaccaggcagttcatgcgttccgtgtcctcctcgtccaccgcctcggcc
tcggccaagaagataatcgtcaagcacgtgacggtcatcggcggcgggctgatgggcgcc
ggcattgcccaggttgctgcagcaactggtcacacagtagtgttggtagaccagacagag
gacatcctggcaaaatccaaaaagggaattgaggaaagccttaggaaagtggcaaagaag
aagtttgcagaaaaccttaaggccggcgatgaatttgtggagaagaccctgagcaccata
gcgaccagcacggatgcagcctccgttgtccacagcacagacttggtggtggaagccatc
gtggagaatctgaaggtgaaaaacgagctcttcaaaaggctggacaagtttgctgctgaa
catacaatctttgccagcaacacttcctccttgcagattacaagcatagctaatgccacc
accagacaagaccgattcgctggcctccatttcttcaacccagtgcctgtcatgaaactt
gtggaggtcattaaaacaccaatgaccagccagaagacatttgaatctttggtagacttt
agcaaagccctaggaaagcatcctgtttcttgcaaggacactcctgggtttattgtgaac
cgcctcctggttccatacctcatggaagcaatcaggctgtatgaacgaggtgacgcatcc
aaagaagacattgacactgctatgaaattaggagccggttaccccatgggcccatttgag
cttctagattatgtcggactggatactacgaagttcatcgtggatgggtggcatgaaatg
gatgcagagaacccattacatcagcccagcccatccttaaataagctggtagcagagaac
aagttcggcaagaagactggagaaggattttacaaatacaagtga

DBGET integrated database retrieval system