KEGG   Homo sapiens (human): 3067
Entry
3067              CDS       T01001                                 
Symbol
HDC
Name
(RefSeq) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00340  Histidine metabolism
hsa01100  Metabolic pathways
Network
nt06037  Histidine metabolism
  Element
N01729  Histamine biosynthesis
Disease
H00862  Tourette syndrome
Drug target
Brocresine: D03158
Tritoqualine: D07405
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    3067 (HDC)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     3067 (HDC)
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-GeneID: 3067
NCBI-ProteinID: NP_002103
OMIM: 142704
HGNC: 4855
Ensembl: ENSG00000140287
LinkDB
Position
15:complement(50241947..50265726)
AA seq 662 aa
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgatggagcctgaggagtacagagagagagggagagagatggtggattacatctgccag
tacctgagcactgtgcgggagagacgtgtgacgccagacgtgcagcctggctacctgcga
gcccagctgcctgagagtgctcctgaggaccccgacagctgggacagcatctttggggac
attgaacgaatcatcatgcctggggtggtacattggcagagcccccatatgcacgcctac
tacccagccctcacctcttggccctccctgctaggagacatgctggctgatgccatcaac
tgcttgggattcacctgggcatccagccctgcgtgtacagagctggagatgaacgtcatg
gactggttggcaaaaatgctgggacttccagagcacttcttgcaccaccaccccagcagc
cagggcggaggcgtcctgcagagcacggtcagtgaatccactttgattgccctgctggca
gcaaggaagaacaaaatcctggaaatgaaaacgtctgagcccgatgctgatgagtcctgc
ctaaatgcccgactcgtggcctatgcctctgaccaggctcactcctctgtggaaaaggct
ggtttgatttcccttgtgaagatgaaatttctgcctgtggatgacaacttctcactccga
ggggaagctcttcagaaggccatcgaggaagacaagcagcggggcttggtgcccgtcttt
gtctgtgcaacactagggaccactggggtctgtgcatttgactgcctgtcagagctgggc
cccatctgtgcccgtgaggggctgtggctccacatcgatgctgcttatgcaggcactgcc
ttcctgtgccccgagttccgggggtttctgaaggggattgagtatgccgactccttcacc
tttaatccttccaagtggatgatggtgcattttgactgtactgggttctgggtcaaggac
aagtacaagctgcagcagaccttcagtgtgaatcccatctacctcaggcatgccaactca
ggcgtggccaccgacttcatgcactggcagatccccctgagccgacggtttcgctctgtt
aaactctggttcgtgattcggtccttcggggtgaagaatcttcaagcacatgtcagacat
ggtactgaaatggctaaatattttgaatctctggtcagaaacgacccttcctttgaaatt
cctgccaagaggcaccttggcctggtggtttttcgtctaaagggtcctaattgtctcaca
gaaaatgtgttaaaggaaatagctaaagctggccgtctcttcctcatcccggccactatc
caggacaagttaatcatccgtttcactgtgacatcccagtttaccactagggatgacatc
ctgagagactggaatctcattcgagatgctgccactctcatcctgagtcagcactgtact
tcccaacccagccctcgggttgggaacctcatctcccaaatcaggggtgccagagcctgg
gcctgtggaacgtcccttcagtctgtcagtggggcaggagatgatccagtccaggccagg
aagatcatcaagcagcctcagcgtgtgggagccggtcccatgaaaagggaaaatggcctc
catcttgaaaccctgctggacccagttgatgactgcttttcagaagaggccccagatgcc
accaagcacaagctgtcctccttcctgttcagttacttgtctgtgcagactaagaagaag
acggtgcgctccctcagttgcaacagtgtgccagtgagtgctcagaagccactgcccaca
gaggcctctgtgaagaatgggggctcctccagggtcagaatcttttccaggtttccagaa
gacatgatgatgctgaagaaaagtgccttcaaaaaactcatcaaattctacagcgtcccc
agctttcctgaatgcagctctcaatgtggactccagctgccctgttgccctctgcaggcc
atggtttag

DBGET integrated database retrieval system