KEGG   Homo sapiens (human): 3672
Entry
3672              CDS       T01001                                 
Symbol
ITGA1, CD49a, VLA1
Name
(RefSeq) integrin subunit alpha 1
  KO
K06480  integrin alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04640  Hematopoietic cell lineage
hsa04810  Regulation of actin cytoskeleton
hsa04820  Cytoskeleton in muscle cells
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06167  Human cytomegalovirus (HCMV)
nt06180  Pathogenic Escherichia coli
nt06181  Salmonella
nt06182  Shigella
nt06183  Yersinia
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00951  ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3672 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3672 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3672 (ITGA1)
  09142 Cell motility
   04820 Cytoskeleton in muscle cells
    3672 (ITGA1)
   04810 Regulation of actin cytoskeleton
    3672 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3672 (ITGA1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3672 (ITGA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3672 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3672 (ITGA1)
   05414 Dilated cardiomyopathy
    3672 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3672 (ITGA1)
   04515 Cell adhesion molecules [BR:hsa04515]
    3672 (ITGA1)
   04090 CD molecules [BR:hsa04090]
    3672 (ITGA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   3672 (ITGA1)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3672 (ITGA1)
CD molecules [BR:hsa04090]
 Proteins
  3672 (ITGA1)
SSDB
Motif
Pfam: VWA FG-GAP Integrin_A_Ig_2 Integrin_A_Ig_1 Integrin_A_Ig_3 VWA_2 FG-GAP_3 FG-GAP_2 LYRIC Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 3672
NCBI-ProteinID: NP_852478
OMIM: 192968
HGNC: 6134
Ensembl: ENSG00000213949
UniProt: P56199
Structure
LinkDB
Position
5:52787916..52959209
AA seq 1179 aa
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKLDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVQECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTTDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPIKQTCCSSRQHNSCTTENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRRGEMVT
FKILFQFNTSYLMENVTIYLSATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDIS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggcccctcggccccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacgctgctgcgtatcattcaatgttgatgtgaaaaattcaatgactttcagc
ggcccggtggaagacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctccgttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagttggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaggagaacatgacatttggatcaactttagtc
accaacccaaatggaggatttctggcttgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagccccacatttcaagtcgtgaattcc
attgcccctgtacaagaatgcagcactcaactggacatagtcatagtgctggatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaacgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgaca
gatggagagtctcatgacaatcatcgactgaagaaggtcatccaagactgtgaagatgaa
aacattcaacggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagtgaacccactgaaaagcatttcttc
aatgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagccacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctagtcaaatcataatccctcgaaacacaacc
tttaatgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagacg
ctcagtggagaacagattggttcctactttggcagtattttaacaacaactgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacagagaag
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctattaagcagacgtgctgttcatctcggcagcacaattcatgcacaaca
gaaaacaaaaatgagccatgcggggctcgttttggaactgcaattgctgctgtaaaagac
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagactataaggaaagagtatgcacaacgt
attccatcaggtggggatggtaagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggtgacggtctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgagccaaataaa
gtgaatattcaaaagaaaaactgccatatggagggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaagtctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaagacaaatatcacgaagttttttctctggaact
caagagagaaaggttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactctgtgagaataacgttggactttaat
cttaccgatccagaaaatgggcctgttcttgatgattctctaccaaactcagtacatgaa
tatattccctttgccaaagattgtggaaataaggaaaaatgtatctcagacctcagcctg
catgtcgccaccactgaaaaggacctgctgattgtccgatcccagaatgataagttcaac
gttagcctcacagtcaaaaatacaaaggacagtgcctataacaccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagttgtgaatct
aatcataatatcacatgtaaagttggatatcccttcctgagaagaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcatggaaaatgtgaccatttattta
agtgcaacaagtgacagcgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctatcccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctactgaggacattgga
aatgaaattaatatcttctacttgattagaaaaagtggatcttttccaatgccagagctt
aagctgtcaatttcattccccaatatgacatcaaatggttaccctgtgctgtacccaact
ggattgtcatcttctgagaatgcaaactgcagaccccatatctttgaggatcctttcagt
atcaactctggaaagaaaatgactacatcaactgaccatctcaaacgaggcacaattctg
gactgcaatacatgtaaatttgctaccatcacatgtaatctcacttcttctgacatcagc
caagtcaatgtttcgcttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatgcatctctggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatgggctaccgggcagagtg
ccattatgggtcatcctgctgagtgcttttgccggattgttgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

DBGET integrated database retrieval system