KEGG   Homo sapiens (human): 3679
Entry
3679              CDS       T01001                                 

Gene name
ITGA7
Definition
(RefSeq) integrin subunit alpha 7
  KO
K06583  integrin alpha 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa05165  Human papillomavirus infection
hsa05410  Hypertrophic cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoGAP-RhoA signaling pathway
N00951  ITGA/B-RHOG-RAC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H00590  Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    3679 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3679 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3679 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3679 (ITGA7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    3679 (ITGA7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    3679 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    3679 (ITGA7)
   05414 Dilated cardiomyopathy
    3679 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3679 (ITGA7)
   04515 Cell adhesion molecules [BR:hsa04515]
    3679 (ITGA7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3679 (ITGA7)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3679 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF3488 LYRIC DUF2207
Other DBs
NCBI-GeneID: 3679
NCBI-ProteinID: NP_001138468
OMIM: 600536
HGNC: 6143
Ensembl: ENSG00000135424
Vega: OTTHUMG00000170699
Pharos: Q13683(Tbio)
UniProt: Q13683 Q4LE35
LinkDB
Position
12q13.2
AA seq 1141 aa
MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY
VYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILH
VSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRL
RGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYS
LQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCT
RVSDTEFQPLPMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVM
LPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETT
ELEVELLLATISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDV
GSKVKYEVTVSNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCS
PRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTAN
CVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDA
STVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVP
QYHAVKIPREDRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGT
A
NT seq 3426 nt   +upstreamnt  +downstreamnt
atggccggggctcggagccgcgacccttggggggcctccgggatttgctacctttttggc
tccctgctcgtcgaactgctcttctcacgggctgtcgccttcaatctggacgtgatgggt
gccttgcgcaaggagggcgagccaggcagcctcttcggcttctctgtggccctgcaccgg
cagttgcagccccgaccccagagctggctgctggtgggtgctccccaggccctggctctt
cctgggcagcaggcgaatcgcactggaggcctcttcgcttgcccgttgagcctggaggag
actgactgctacagagtggacatcgaccagggagctgatatgcaaaaggaaagcaaggag
aaccagtggttgggagtcagtgttcggagccaggggcctgggggcaagattgttacctgt
gcacaccgatatgaggcaaggcagcgagtggaccagatcctggagacgcgggatatgatt
ggtcgctgctttgtgctcagccaggacctggccatccgggatgagttggatggtggggaa
tggaagttctgtgagggacgcccccaaggccatgaacaatttgggttctgccagcagggc
acagctgccgccttctcccctgatagccactacctcctctttggggccccaggaacctat
aattggaagggcacggccagggtggagctctgtgcacagggctcagcggacctggcacac
ctggacgacggtccctacgaggcggggggagagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttggcttctctattgactcggggaaaggtctggtgcgtgca
gaagagctgagctttgtggctggagccccccgcgccaaccacaagggtgctgtggtcatc
ctgcgcaaggacagcgccagtcgcctggtgcccgaggttatgctgtctggggagcgcctg
acctccggctttggctactcactggctgtggctgacctcaacagtgatggctggccagac
ctgatagtgggtgccccctacttctttgagcgccaagaagagctggggggtgctgtgtat
gtgtacttgaaccaggggggtcactgggctgggatctcccctctccggctctgcggctcc
cctgactccatgttcgggatcagcctggctgtcctgggggacctcaaccaagatggcttt
ccagatattgcagtgggtgccccctttgatggtgatgggaaagtcttcatctaccatggg
agcagcctgggggttgtcgccaaaccttcacaggtgctggagggcgaggctgtgggcatc
aagagcttcggctactccctgtcaggcagcttggatatggatgggaaccaataccctgac
ctgctggtgggctccctggctgacaccgcagtgctcttcagggccagacccatcctccat
gtctcccatgaggtctctattgctccacgaagcatcgacctggagcagcccaactgtgct
ggcggccactcggtctgtgtggacctaagggtctgtttcagctacattgcagtccccagc
agctatagccctactgtggccctggactatgtgttagatgcggacacagaccggaggctc
cggggccaggttccccgtgtgacgttcctgagccgtaacctggaagaacccaagcaccag
gcctcgggcaccgtgtggctgaagcaccagcatgaccgagtctgtggagacgccatgttc
cagctccaggaaaatgtcaaagacaagcttcgggccattgtagtgaccttgtcctacagt
ctccagacccctcggctccggcgacaggctcctggccaggggctgcctccagtggccccc
atcctcaatgcccaccagcccagcacccagcgggcagagatccacttcctgaagcaaggc
tgtggtgaagacaagatctgccagagcaatctgcagctggtccgcgcccgcttctgtacc
cgggtcagcgacacggaattccaacctctgcccatggatgtggatggaacaacagccctg
tttgcactgagtgggcagccagtcattggcctggagctgatggtcaccaacctgccatcg
gacccagcccagccccaggctgatggggatgatgcccatgaagcccagctcctggtcatg
cttcctgactcactgcactactcaggggtccgggccctggaccctgcggagaagccactc
tgcctgtccaatgagaatgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcatccttagcacctccgggatcagcattgagaccacg
gaactggaggtagagctgctgttggccacgatcagtgagcaggagctgcatccagtctct
gcacgagcccgtgtcttcattgagctgccactgtccattgcaggaatggccattccccag
caactcttcttctctggtgtggtgaggggcgagagagccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggtcacggtttccaaccaaggccagtcgctcagaaccctg
ggctctgccttcctcaacatcatgtggcctcatgagattgccaatgggaagtggttgctg
tacccaatgcaggttgagctggagggcgggcaggggcctgggcagaaagggctttgctct
cccaggcccaacatcctccacctggatgtggacagtagggataggaggcggcgggagctg
gagccacctgagcagcaggagcctggtgagcggcaggagcccagcatgtcctggtggcca
gtgtcctctgctgagaagaagaaaaacatcaccctggactgcgcccggggcacggccaac
tgtgtggtgttcagctgcccactctacagctttgaccgcgcggctgtgctgcatgtctgg
ggccgtctctggaacagcacctttctggaggagtactcagctgtgaagtccctggaagtg
attgtccgggccaacatcacagtgaagtcctccataaagaacttgatgctccgagatgcc
tccacagtgatcccagtgatggtatacttggaccccatggctgtggtggcagaaggagtg
ccctggtgggtcatcctcctggctgtactggctgggctgctggtgctagcactgctggtg
ctgctcctgtggaagatgggattcttcaaacgggcgaagcaccccgaggccaccgtgccc
cagtaccatgcggtgaagattcctcgggaagaccgacagcagttcaaggaggagaagacg
ggcaccatcctgaggaacaactggggcagcccccggcgggagggcccggatgcacacccc
atcctggctgctgacgggcatcccgagctgggccccgatgggcatccagggccaggcacc
gcctag

DBGET integrated database retrieval system