KEGG   Homo sapiens (human): 440567
Entry
440567            CDS       T01001                                 
Symbol
UQCRHL, hCG25371
Name
(RefSeq) ubiquinol-cytochrome c reductase hinge protein like
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
N01395  Cadmium to electron transfer in complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    440567 (UQCRHL)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    440567 (UQCRHL)
  09159 Environmental adaptation
   04714 Thermogenesis
    440567 (UQCRHL)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    440567 (UQCRHL)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    440567 (UQCRHL)
   05012 Parkinson disease
    440567 (UQCRHL)
   05014 Amyotrophic lateral sclerosis
    440567 (UQCRHL)
   05016 Huntington disease
    440567 (UQCRHL)
   05020 Prion disease
    440567 (UQCRHL)
   05022 Pathways of neurodegeneration - multiple diseases
    440567 (UQCRHL)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    440567 (UQCRHL)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    440567 (UQCRHL)
SSDB
Motif
Pfam: UCR_hinge Syntaxin-6_N
Other DBs
NCBI-GeneID: 440567
NCBI-ProteinID: NP_001083060
HGNC: 51714
Ensembl: ENSG00000233954
UniProt: A0A096LP55
LinkDB
Position
1:complement(15807374..15807649)
AA seq 91 aa
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctatgatgagcatgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcaaaggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

DBGET integrated database retrieval system