KEGG   Homo sapiens (human): 4913
Entry
4913              CDS       T01001                                 
Symbol
NTHL1, FAP3, NTH1, OCTS3, hNTH1
Name
(RefSeq) nth like DNA glycosylase 1
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
Network
nt06504  Base excision repair
  Element
N01434  Base excision and strand cleavage by bifunctional glycosylase
Disease
H01025  Familial adenomatous polyposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    4913 (NTHL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4913 (NTHL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     4913 (NTHL1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     4913 (NTHL1)
 Prokaryotic type
     4913 (NTHL1)
SSDB
Motif
Pfam: HhH-GPD HHH HHH_5 HHH_3
Other DBs
NCBI-GeneID: 4913
NCBI-ProteinID: NP_002519
OMIM: 602656
HGNC: 8028
Ensembl: ENSG00000065057
Pharos: P78549(Tbio)
UniProt: P78549 E5KTI5
Structure
LinkDB
Position
16:complement(2039820..2047834)
AA seq 304 aa
MTALSARMLTRSRSLGPGAGPRGCREEPGPLRRREAAAEARKSHSPVKRPRKAQRLRVAY
EGSDSEKGEGAEPLKVPVWEPQDWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVR
RYQVLLSLMLSSQTKDQVTAGAMQRLRARGLTVDSILQTDDATLGKLIYPVGFWRSKVKY
IKQTSAILQQHYGGDIPASVAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANR
LRWTKKATKSPEETRAALEEWLPRELWHEINGLLVGFGQQTCLPVHPRCHACLNQALCPA
AQGL
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaccgccttgagcgcgaggatgctgacccggagccggagcctgggacccggggctggg
ccgcgggggtgtagggaggagcccgggcctctccggagaagagaggctgcagcagaagcg
aggaaaagccacagccccgtgaagcgtccgcggaaagcacagagactgcgtgtggcctat
gagggctcggacagtgagaaaggtgagggggctgagcccctcaaggtgccagtctgggag
ccccaggactggcagcaacagctggtcaacatccgtgccatgaggaacaaaaaggatgca
cctgtggaccatctggggactgagcactgctatgactccagtgcccccccaaaggtacgc
aggtaccaggtgctgctgtcactgatgctctccagccaaaccaaagaccaggtgacggcg
ggcgccatgcagcgactgcgggcgcggggcctgacggtggacagcatcctgcagacagat
gatgccacgctgggcaagctcatctaccccgtcggtttctggaggagcaaggtgaaatac
atcaagcagaccagcgccatcctgcagcagcactacggtggggacatcccagcctctgtg
gccgagctggtggcgctgccgggtgttgggcccaagatggcacacctggctatggctgtg
gcctggggcactgtgtcaggcattgcagtggacacgcatgtgcacagaatcgccaacagg
ctgaggtggaccaagaaggcaaccaagtccccagaggagacccgcgccgccctggaggag
tggctgcctagggagctgtggcacgagatcaatggactcttggtgggcttcggccagcag
acctgtctgcctgtgcaccctcgctgccacgcctgcctcaaccaagccctctgcccggcc
gcccagggtctctga

DBGET integrated database retrieval system