KEGG   Homo sapiens (human): 4927
Entry
4927              CDS       T01001                                 
Symbol
NUP88, FADS4
Name
(RefSeq) nucleoporin 88
  KO
K14318  nuclear pore complex protein Nup88
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Disease
H00987  Fetal akinesia deformation sequence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    4927 (NUP88)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4927 (NUP88)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4927 (NUP88)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     4927 (NUP88)
SSDB
Motif
Pfam: Nup88
Other DBs
NCBI-GeneID: 4927
NCBI-ProteinID: NP_002523
OMIM: 602552
HGNC: 8067
Ensembl: ENSG00000108559
Vega: OTTHUMG00000099453
Pharos: Q99567(Tbio)
UniProt: Q99567
LinkDB
Position
17:complement(5384833..5419662)
AA seq 741 aa
MAAAEGPVGDGELWQTWLPNHVVFLRLREGLKNQSPTEAEKPASSSLPSSPPPQLLTRNV
VFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQ
HHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYP
SEILDPHVVLLTSDNVIRIYSLREPQTPTNVIILSEAEEESLVLNKGRAYTASLGETAVA
FDFGPLAAVPKTLFGQNGKDEVVAYPLYILYENGETFLTYISLLHSPGNIGKLLGPLPMH
PAAEDNYGYDACAVLCLPCVPNILVIATESGMLYHCVVLEGEEEDDHTSEKSWDSRIDLI
PSLYVFECVELELALKLASGEDDPFDSDFSCPVKLHRDPKCPSRYHCTHEAGVHSVGLTW
IHKLHKFLGSDEEDKDSLQELSTEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPTM
ICITSTYECLIWPLLSTVHPASPPLLCTREDVEVAESPLRVLAETPDSFEKHIRSILQRS
VANPAFLKASEKDIAPPPEECLQLLSRATQVFREQYILKQDLAKEEIQRRVKLLCDQKKK
QLEDLSYCREERKSLREMAERLADKYEEAKEKQEDIMNRMKKLLHSFHSELPVLSDSERD
MKKELQLIPDQLRHLGNAIKQVTMKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQSILKE
EGEHIREMVKQINDIRNHVNF
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcggccgccgagggaccggtgggcgacggcgagctgtggcagacctggcttcctaac
cacgtcgtgttcttgcggctccgggagggactgaaaaaccagagtccaaccgaagctgag
aaaccagcttcttcgtcgttgccttcgtcgccgccgccgcagttgctgacgagaaacgtg
gtctttggcctcggcggagagcttttcctgtgggacggagaagacagctccttcttagtc
gttcgccttcggggccccagcggcggcggcgaagagcccgccctgtcccagtaccagaga
ttgctttgcataaatccacccctgtttgaaatctatcaagtcttgttaagcccaacacaa
catcatgtagcacttataggaataaaaggacttatggtattagaattacctaaaagatgg
gggaagaattctgaatttgaaggtggaaaatcaacagtgaattgtagtaccactccagtt
gcggagagatttttcaccagttccacctctctgactctaaagcatgctgcatggtatcca
agtgaaatcctggatccccacgtagtgctgttaacatcagacaacgtaatcagaatttac
tcactacgtgagccgcagacacccactaacgtgataatactttcagaagccgaagaggaa
agtctagtactcaataaaggaagggcgtataccgcatctctaggagagacagcagttgca
tttgactttgggccattggcagcagtcccaaagactctatttggacaaaacggcaaagat
gaagtagtggcatacccactgtacatcttatatgaaaatggagagactttcctgacatac
atcagtctgttacacagccctggaaatattggaaagctgttgggtccattgcccatgcat
cctgcggctgaagataactatggttatgatgcgtgtgctgtactctgcttaccctgtgtc
cccaatatcttagtgatcgctactgaatcaggaatgctgtatcactgtgtcgtgctagaa
ggggaagaagaagatgaccacacgtcagaaaagtcctgggattccaggattgacctcatt
ccttctctgtatgtgtttgaatgtgttgagttggagcttgctttgaaactggcatctgga
gaggatgacccttttgattctgacttttcttgtccagtcaaacttcatagagatcccaag
tgtccttcaagatatcactgtactcatgaagctggtgtacatagtgttgggctaacttgg
attcataaacttcacaaatttcttggatcagatgaagaagataaggatagtttacaggaa
ctctctacagaacagaaatgctttgttgaacacatcctttgtacgaagccattgccctgc
aggcagccagctccaattcgaggattttggattgtacctgacattctgggacccacgatg
atctgcatcaccagtacctatgaatgcctcatatggccgttattaagtacagtccatcca
gcgtctcctcccctgctttgtactcgagaagatgttgaagtggcagagtctcccctccgt
gttctggctgaaaccccagattcctttgaaaagcatattagaagcattttgcaacgtagt
gttgccaatccagcatttttgaaagcttctgaaaaggacatagcccctcctcctgaagaa
tgccttcagctcctcagcagagccacccaggtgttcagagagcagtacattctcaaacag
gacttggcaaaggaggagattcagcggagggtcaaattattatgtgaccaaaaaaagaaa
caactagaagatctcagttattgtcgagaagagaggaaaagtctgcgggaaatggctgag
cgtttagctgacaaatatgaggaagctaaagaaaaacaagaggatatcatgaacaggatg
aaaaaactacttcacagttttcactctgagctcccagttctctctgatagtgagcgagac
atgaagaaagaattacagctgatacctgatcaacttcgacatttgggcaatgccatcaaa
caggttactatgaaaaaggattatcaacagcaaaagatggagaaggtgttgagtcttcca
aaacccaccattattctcagtgcctaccagcgaaagtgcattcagtccatcctgaaagag
gagggtgaacatataagggaaatggtgaagcaaatcaatgatatccgcaatcatgtaaac
ttctga

DBGET integrated database retrieval system