Entry |
|
Symbol |
ANAPC11, APC11, Apc11p, HSPC214
|
Name |
(RefSeq) anaphase promoting complex subunit 11
|
KO |
K03358 | anaphase-promoting complex subunit 11 |
|
Organism |
|
Pathway |
hsa04914 | Progesterone-mediated oocyte maturation |
hsa05166 | Human T-cell leukemia virus 1 infection |
|
Network |
nt06130 Cell cycle (viruses) nt06160 Human T-cell leukemia virus 1 (HTLV-1) nt06230 Cell cycle nt06512 Chromosome cohesion and segregation nt06515 Regulation of kinetochore-microtubule interactions |
Element |
N00221 | HTLV-1 Tax to spindle assembly checkpoint signaling |
N00493 | Spindle assembly checkpoint signaling |
N01486 | Cohesin dissociation in anaphase |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04120 Ubiquitin mediated proteolysis
51529 (ANAPC11)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
51529 (ANAPC11)
04114 Oocyte meiosis
51529 (ANAPC11)
09150 Organismal Systems
09152 Endocrine system
04914 Progesterone-mediated oocyte maturation
51529 (ANAPC11)
09160 Human Diseases
09172 Infectious disease: viral
05166 Human T-cell leukemia virus 1 infection
51529 (ANAPC11)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04121 Ubiquitin system [BR:hsa04121]
51529 (ANAPC11)
03036 Chromosome and associated proteins [BR:hsa03036]
51529 (ANAPC11)
Ubiquitin system [BR:hsa04121]
Ubiquitin ligases (E3)
Multi subunit Ring-finger type E3
APC/C
Ring finger protein
51529 (ANAPC11)
Chromosome and associated proteins [BR:hsa03036]
Eukaryotic type
Sister chromatid separation proteins
APC/C complex
51529 (ANAPC11)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
LinkDB |
|
Position |
17:81890790..81900533
|
AA seq |
84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE |
NT seq |
255 nt +upstreamnt +downstreamnt
atgaaggtgaagattaagtgctggaacggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcatttaacggatgctgccctgactgcaaggtgccc
ggcgacgactgcccgctggtgtggggccagtgctcccactgcttccacatgcattgcatc
ctcaagtggctgcacgcacagcaggtgcagcagcactgccccatgtgccgccaggaatgg
aagttcaaggagtga |