KEGG   Homo sapiens (human): 55215
Entry
55215             CDS       T01001                                 
Symbol
FANCI, KIAA1794
Name
(RefSeq) FA complementation group I
  KO
K10895  fanconi anemia group I protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Network
nt06508  Interstrand crosslink repair
  Element
N01464  Fanconi anemia pathway
N01465  Lesion bypass by TLS and DSB formation
N01466  Homologous recombination in ICLR
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    55215 (FANCI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    55215 (FANCI)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     55215 (FANCI)
SSDB
Motif
Pfam: FANCI_S4 FANCI_HD2 FANCI_S3 FANCI_S1 FANCI_S2 FANCI_HD1 FANCI_S1-cap DUF3894 Ribul_P_3_epim DUF3972 RPAP3_C
Other DBs
NCBI-GeneID: 55215
NCBI-ProteinID: NP_001106849
OMIM: 611360
HGNC: 25568
Ensembl: ENSG00000140525
Pharos: Q9NVI1(Tbio)
UniProt: Q9NVI1
Structure
LinkDB
Position
15:89243979..89317259
AA seq 1328 aa
MDQKILSLAAEKTADKLQEFLQTLREGDLTNLLQNQAVKGKVAGALLRAIFKGSPCSEEA
GTLRRRKIYTCCIQLVESGDLQKEIASEIIGLLMLEAHHFPGPLLVELANEFISAVREGS
LVNGKSLELLPIILTALATKKENLAYGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSM
FKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSAL
DKQHNEEQSGDELLDVVTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGD
SNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYV
STMILEVVKNSVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPSLSRMPNQHACK
LGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHFLDLLSNIVMYAPLVLQSCSSK
VTEAFDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGF
LLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVANETFCLEIMDSLRRCLSQQAD
VRLMLYEGFYDVLRRNSQLANSVMQTLLSQLKQFYEPKPDLLPPLKLEACILTQGDKISL
QEPLDYLLCCIQHCLAWYKNTVIPLQQGEEEEEEEEAFYEDLDDILESITNRMIKSELED
FELDKSADFSQSTSIGIKNNICAFLVMGVCEVLIEYNFSISSFSKNRFEDILSLFMCYKK
LSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRDSIQSHQESLSVLRSSNEFMR
YAVNVALQKVQQLKETGHVSGPDGQNPEKIFQNLCDITRVLLWRYTSIPTSVEESGKKEK
GKSISLLCLEGLQKIFSAVQQFYQPKIQQFLRALDVTDKEGEEREDADVSVTQRTAFQIR
QFQRSLLNLLSSQEEDFNSKEALLLVTVLTSLSKLLEPSSPQFVQMLSWTSKICKENSRE
DALFCKSLMNLLFSLHVSYKSPVILLRDLSQDIHGHLGDIDQDVEVEKTNHFAIVNLRTA
APTVCLLVLSQAEKVLEEVDWLITKLKGQVSQETLSEEASSQATLPNQPVEKAIIMQLGT
LLTFFHELVQTALPSGSCVDTLLKDLCKMYTTLTALVRYYLQVCQSSGGIPKNMEKLVKL
SGSHLTPLCYSFISYVQNKSKSLNYTGEKKEKPAAVATAMARVLRETKPIPNLIFAIEQY
EKFLIHLSKKSKVNLMQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKE
PAKKKRKK
NT seq 3987 nt   +upstreamnt  +downstreamnt
atggaccagaagattttatctctagcagcagaaaaaacagcagacaaactgcaagaattt
cttcaaaccctgagagaaggtgatttgactaatctccttcagaatcaagcagtgaaagga
aaagttgctggagcactcctgagagccatcttcaaaggttccccctgctctgaggaagct
ggaacacttaggagacgtaagatatacacttgttgtatccagttggtggaatcgggggat
ttgcagaaagaaatagcgtctgagatcataggattactgatgctggaggctcaccatttt
ccaggaccattattggttgaattagccaatgagtttattagtgctgtcagagaaggcagc
ctagtgaatggaaaatctttggagttactacctatcattctcactgccctggctacgaaa
aaggaaaatctggcttatggaaaaggtgtactgagtggggaagaatgtaagaaacagttg
attaacaccctgtgttctggcaggtgggatcagcaatatgtaatccaactcacctccatg
ttcaaggatgtccctctgactgcagaagaggtggaatttgtggtggaaaaagcattgagc
atgttctccaagatgaatcttcaagaaataccacctttggtctatcagcttctggttctc
tcctccaagggaagcagaaagagtgttttggaaggaatcatagccttcttcagtgcacta
gataagcagcacaatgaggaacagagtggtgacgagctattggatgttgtcactgtgcca
tcaggtgaacttcgtcatgtggaaggcaccattattctacacattgtgtttgccatcaaa
ttggactatgaactaggcagagaactcgtgaaacacttaaaggtaggacagcaaggagat
tccaataataacttaagtcccttcagcattgctcttcttctgtctgtaacaagaatacaa
agatttcaggaccaggtgcttgatcttttaaagacttcggttgtaaagagctttaaggat
cttcaactcctccaaggctcaaaatttcttcagaatctagttcctcatagatcttatgtt
tcaaccatgatcttggaagtagtgaagaatagcgttcatagctgggaccatgttactcag
ggcctcgtagaacttggtttcattttgatggattcatatgggccaaagaaggttcttgat
ggaaaaactattgaaaccagcccaagtctttctagaatgccaaaccagcatgcatgtaag
ctcggagctaatatcctgttggaaacttttaagatccatgagatgatcagacaagaaatt
ttggagcaggtcctcaacagggttgttaccagagcatcttctcccatcagtcatttctta
gacctgctttcaaatatcgtcatgtatgcacccttagttcttcaaagttgttcttctaaa
gtcacagaagcttttgactatttgtcctttctgccccttcagactgtacaaaggctgctt
aaggcagtgcagccccttctcaaagtcagcatgtcaatgagagactgcttgatacttgtc
cttcggaaagctatgtttgccaaccagcttgatgcccgaaaatctgcagttgctgggttt
ttgctgctcctgaagaactttaaagttttaggcagcctgtcatcctctcagtgcagtcag
tctctcagtgtcagtcaggttcatgtggatgttcacagccattacaattctgtcgccaat
gaaactttttgccttgagatcatggatagtttgaggagatgcttaagccagcaagctgat
gttcgactcatgctttatgaggggttttatgatgttcttcgaaggaactctcagctggct
aattcagtcatgcaaactctgctctcacagttaaaacagttctatgagccaaaacctgat
ctgctgcctcctctgaaattagaagcttgtattctgacccaaggagataagatctctcta
caagaaccactggattatctgctgtgttgtattcagcattgtttggcctggtataagaat
acagtcatacccttacagcagggagaggaggaagaggaggaggaagaggcattctacgaa
gacctagatgatatattggagtccattactaatagaatgattaagagtgagctggaagac
tttgaactggataaatcagcagatttttctcagagcaccagtattggcataaaaaataat
atctgtgcttttcttgtgatgggagtttgtgaggttttaatagaatacaatttctccata
agtagtttcagtaagaataggtttgaggacattctgagcttatttatgtgttacaaaaaa
ctctctgacattcttaatgaaaaagcgggtaaagccaaaactaaaatggccaacaagaca
agtgatagtcttttgtccatgaaatttgtgtccagtcttctcactgctcttttcagggat
agtatccaaagccaccaagaaagcctttctgttctcaggtccagcaatgagtttatgcgc
tatgcagtgaatgtagctctgcagaaagtacagcagctaaaggaaacagggcatgtgagt
ggccctgatggccaaaacccagaaaagatctttcagaacctctgtgacataactcgagtc
ttgctatggagatacacttcaattcctacttcagtggaagagtcgggaaagaaagagaaa
ggaaagagcatctcactgctgtgcttggagggtttacagaaaatattcagtgctgtgcaa
cagttctatcagcccaagattcagcagtttctcagagctctggatgtcacagataaggaa
ggagaagagagagaagatgcagatgtcagtgtcactcagagaacagcattccagatccgg
caatttcagaggtccttgttgaatttacttagcagtcaagaggaagattttaatagcaaa
gaagccctcctgctagtcacggttcttaccagtttgtccaagttactggagccctcctct
cctcagtttgtgcagatgttatcctggacatcaaagatttgcaaggaaaacagccgggag
gatgccttgttttgcaagagcttgatgaacttgctcttcagcctgcatgtttcgtataag
agtcctgtcattctgctgcgtgacttgtcccaggatatccacgggcatctgggagatata
gaccaggatgtagaggtggagaaaacaaaccactttgcaatagtgaatttgagaacggct
gcccccactgtctgtttacttgttctgagtcaggccgagaaggttctagaagaagtggac
tggctaatcaccaagcttaagggacaagtgagccaagaaaccttatcagaagaggcctct
tctcaggcaaccctaccaaatcagcctgttgagaaagctatcatcatgcaactgggaact
ctgcttacatttttccacgagctggtgcagacagctctgccatcaggcagctgtgtggac
accttgttaaaggacttgtgcaaaatgtacaccacacttacagcccttgtcagatattat
ctccaggtgtgtcagagctccggaggaattccaaaaaatatggaaaagctggtgaagctg
tctggttctcatctgacccccctgtgttattctttcatttcttacgtacagaataagagt
aagagcctgaactatacgggagagaaaaaggagaaacctgctgccgttgccacagccatg
gccagagttcttcgggaaaccaagccaatccctaacctcatctttgccatagaacagtat
gaaaaatttctcatccacctttctaagaagtccaaggtgaacctgatgcagcacatgaag
ctcagcacctcacgagacttcaagatcaaaggaaacatcctagacatggttcttcgagag
gatggtgaagatgaaaatgaagagggcactgcatcagagcatgggggacagaacaaagaa
ccagccaagaagaaaaggaaaaaataa

DBGET integrated database retrieval system